P21137 (KAPC_CAEEL) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: cAMP-dependent protein kinase catalytic subunit Short name=PKA C EC=2.7.11.11 | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 404 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Composed of two regulatory chains and two catalytic chains. |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding cAMP |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | morphogenesis of an epithelium Inferred from mutant phenotype. Source: WormBase nematode larval developmentInferred from mutant phenotype. Source: WormBase ovipositionInferred from mutant phenotype. Source: WormBase |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cAMP-dependent protein kinase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 13 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform e (identifier: P21137-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform a (identifier: P21137-2) Also known as: Major; The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGN...SILDDPVEDF → MLKFLKPKSSDEGSSKDNKNSASL 349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF | ||||||
| Isoform b (identifier: P21137-3) Also known as: Minor; The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGN...SILDDPVEDF → MLKFLKPKSSDEGSSKDNKNSASL | ||||||
| Isoform c (identifier: P21137-4) The sequence of this isoform differs from the canonical sequence as follows: 1-72: MPTRLDIVGN...DFKQRWENPA → MEEEEWRRRL...SDHWSMKWLF 348-404: ITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF → VSSYPI | ||||||
| Isoform d (identifier: P21137-5) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVED → MSSSSNKKVQVKF | ||||||
| Isoform f (identifier: P21137-6) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGN...SILDDPVEDF → MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETV 349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF | ||||||
| Isoform g (identifier: P21137-7) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDF → MGSMVFIV 349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF | ||||||
| Isoform h (identifier: P21137-8) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGN...SILDDPVEDF → MGNAASGGSS...NGRLAAAETI 349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF | ||||||
| Isoform i (identifier: P21137-9) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDF → MGSMVFIV | ||||||
| Isoform j (identifier: P21137-10) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGN...SILDDPVEDF → MGNAASGGSS...NGRLAAAETI | ||||||
| Isoform k (identifier: P21137-11) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MPTRLDIVGN...SILDDPVEDF → MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETV | ||||||
| Isoform l (identifier: P21137-12) The sequence of this isoform differs from the canonical sequence as follows: 349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF | ||||||
| Isoform m (identifier: P21137-13) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVED → MSSSSNKKVQVKF 349-404: TPPSFSKGES...PQLEELFVEF → EAPFLPKCRG...EKCAKEFAEF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 404 | 404 | cAMP-dependent protein kinase catalytic subunit | PRO_0000086067 | |||||
Regions | |||||||||
| Domain | 81 – 335 | 255 | Protein kinase | ||||||
| Nucleotide binding | 87 – 95 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 204 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 110 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 233 | 1 | Phosphothreonine Potential | ||||||
| Modified residue | 376 | 1 | Phosphothreonine Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 72 | 72 | MPTRL…WENPA → MEEEEWRRRLSAAIRREDEG SLEEDEEDEGFILHPLCRTG PLQMTVKASNSTTTLTPSST TTTSPSMPSSPSDSPSDDFS DDTNTSGVFPLTTALSFPVA PLSPRNTTSSITTGLVKKRR SSSSPEDICREKIPHILLKT SSGVVVPLASRGQRAPAITL QNPPPSAAIRTVPPPSFSTF SVRSLPFKTPNCGSKDDTDA ENMEGLDDDYLRQPTTSTSA PVSPIDHRQVRRGGRGVVVE SQVPNFTAEIFWLKTQLSDH WSMKWLF in isoform c. | VSP_004756 | |||||
| Alternative sequence | 1 – 53 | 53 | MPTRL…PVEDF → MLKFLKPKSSDEGSSKDNKN SASL in isoform a and isoform b. | VSP_004751 | |||||
| Alternative sequence | 1 – 53 | 53 | MPTRL…PVEDF → MLSSSFFRGSMKERKNEALK NHKSKYISGGYLETV in isoform f and isoform k. | VSP_004752 | |||||
| Alternative sequence | 1 – 53 | 53 | MPTRL…PVEDF → MGSMVFIV in isoform g and isoform i. | VSP_004754 | |||||
| Alternative sequence | 1 – 53 | 53 | MPTRL…PVEDF → MGNAASGGSSGGGGSARRGN GGGNNGSDYNNAMVFSNGRL AAAETI in isoform h and isoform j. | VSP_004753 | |||||
| Alternative sequence | 1 – 52 | 52 | MPTRL…DPVED → MSSSSNKKVQVKF in isoform d and isoform m. | VSP_004750 | |||||
| Alternative sequence | 348 – 404 | 57 | ITPPS…LFVEF → VSSYPI in isoform c. | VSP_004757 | |||||
| Alternative sequence | 349 – 404 | 56 | TPPSF…LFVEF → EAPFLPKCRGPGDASNFDDY EEEPLRISGTEKCAKEFAEF in isoform a, isoform f, isoform g, isoform h, isoform l and isoform m. | VSP_004758 | |||||
Experimental info | |||||||||
| Sequence conflict | 148 | 1 | F → L in AAA51610. Ref.1 | ||||||
| Sequence conflict | 220 | 1 | I → V in AAA51610. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, characterization, and expression of the gene for the catalytic subunit of cAMP-dependent protein kinase in Caenorhabditis elegans. Identification of highly conserved and unique isoforms generated by alternative splicing." Gross R.E., Bagchi S., Lu X., Rubin C.S. J. Biol. Chem. 265:6896-6907(1990) [PubMed: 2324104] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM B). Strain: Bristol N2. |
| [2] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M37119 M37118 Genomic DNA. Translation: AAA51610.1.Z82096 Genomic DNA. Translation: CAD45613.1. Z82096 Genomic DNA. Translation: CAD45614.1. Z82096 Genomic DNA. Translation: CAD45615.1. Z82096, Z81511 Genomic DNA. Translation: CAD45616.1. Z82096, Z81511 Genomic DNA. Translation: CAD45617.1. Z82096, Z81511 Genomic DNA. Translation: CAD45618.1. Z82096, Z81511 Genomic DNA. Translation: CAD45619.1. Z82096, Z81511 Genomic DNA. Translation: CAD45620.1. Z82096, Z81511 Genomic DNA. Translation: CAD45621.1. Z82096, Z81511 Genomic DNA. Translation: CAD45622.1. Z82096, Z81511 Genomic DNA. Translation: CAD45623.1. Z82096, Z81511 Genomic DNA. Translation: CAB05034.1. Z82096, Z81511 Genomic DNA. Translation: CAB05035.1. Z81511, Z82096 Genomic DNA. Translation: CAB04168.1. Z81511, Z82096 Genomic DNA. Translation: CAB04169.1. Z81511, Z82096 Genomic DNA. Translation: CAD45583.1. Z81511, Z82096 Genomic DNA. Translation: CAD45584.1. Z81511, Z82096 Genomic DNA. Translation: CAD45585.1. Z81511, Z82096 Genomic DNA. Translation: CAD45586.1. Z81511, Z82096 Genomic DNA. Translation: CAD45587.1. Z81511, Z82096 Genomic DNA. Translation: CAD45588.1. Z81511, Z82096 Genomic DNA. Translation: CAD45589.1. Z81511, Z82096 Genomic DNA. Translation: CAD45590.1. |
| PIR | OKKWC1. A35755. OKKWC2. B35755. T21211. T21212. |
| RefSeq | NP_493605.1. NM_061204.2. NP_493606.1. NM_061205.2. NP_740954.1. NM_170958.2. NP_740955.1. NM_170959.3. NP_740956.1. NM_170960.2. NP_740957.1. NM_170961.1. NP_740958.1. NM_170962.2. NP_740959.1. NM_170963.1. NP_740960.1. NM_170964.2. NP_740961.1. NM_170965.1. NP_740962.1. NM_170966.1. NP_740963.1. NM_170967.2. NP_740964.1. NM_170968.2. |
| UniGene | Cel.177. |
3D structure databases | |
| ProteinModelPortal | P21137. |
| SMR | P21137. Positions 54-404. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-26547N. |
| MINT | MINT-1107666. |
| STRING | P21137. |
Proteomic databases | |
| PRIDE | P21137. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | ZK909.2e; ZK909.2e; ZK909.2. |
| GeneID | 3565407. |
| KEGG | cel:ZK909.2. |
| UCSC | ZK909.2h.1. c. elegans. |
Organism-specific databases | |
| CTD | 3565407. |
| WormBase | ZK909.2a; CE15473; WBGene00002189; kin-1. ZK909.2b; CE15475; WBGene00002189; kin-1. ZK909.2c; CE31755; WBGene00002189; kin-1. ZK909.2d; CE31756; WBGene00002189; kin-1. ZK909.2e; CE31757; WBGene00002189; kin-1. ZK909.2f; CE31758; WBGene00002189; kin-1. ZK909.2g; CE31759; WBGene00002189; kin-1. ZK909.2h; CE31760; WBGene00002189; kin-1. ZK909.2i; CE31761; WBGene00002189; kin-1. ZK909.2j; CE31762; WBGene00002189; kin-1. ZK909.2k; CE31763; WBGene00002189; kin-1. ZK909.2l; CE31764; WBGene00002189; kin-1. ZK909.2m; CE31765; WBGene00002189; kin-1. |
Phylogenomic databases | |
| eggNOG | meNOG05816. |
| InParanoid | P21137. |
| OMA | NAATANK. |
| PhylomeDB | P21137. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.11. 1045. |
Gene expression databases | |
| ArrayExpress | P21137. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_kinase-like_dom. IPR008271. Ser/Thr_kinase_AS. IPR002290. Ser/Thr_kinase_dom. [Graphical view] |
| KO | K04345. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 956345. |
Entry information
| Entry name | KAPC_CAEEL | ||||||||
| Accession | Primary (citable) accession number: P21137 Secondary accession number(s): O18310, O18311 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| SIMILARITY comments Index of protein domains and families |

Clusters with