P21128 (ENDOU_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Poly(U)-specific endoribonuclease EC=3.1.-.- Alternative name(s): Placental protein 11 Short name=PP11 Protein endoU Uridylate-specific endoribonuclease | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 410 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini. Ref.7 |
| Cofactor | Manganese. Ref.7 |
| Subunit structure | Monomer By similarity. |
| Subcellular location | Secreted Potential. |
| Tissue specificity | Placental-specific, but also associated with various malignant neoplasms. |
| Post-translational modification | It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both. |
| Sequence similarities | Belongs to the ENDOU family. Contains 2 SMB (somatomedin-B) domains. |
| Caution | Was originally (Ref.1) thought to be a serine protease. However, Ref.7 showed it is not the case. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P21128-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P21128-2) The sequence of this isoform differs from the canonical sequence as follows: 19-59: Missing. | ||||||
| Isoform 3 (identifier: P21128-3) The sequence of this isoform differs from the canonical sequence as follows: 19-82: GKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASN → D | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | |||||||||
| Chain | 19 – 410 | 392 | Poly(U)-specific endoribonuclease | PRO_0000036405 | |||||||
Regions | |||||||||||
| Domain | 20 – 62 | 43 | SMB 1 | ||||||||
| Domain | 86 – 130 | 45 | SMB 2 | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 24 ↔ 40 | Alternate By similarity | |||||||||
| Disulfide bond | 24 ↔ 28 | Alternate By similarity | |||||||||
| Disulfide bond | 28 ↔ 58 | Alternate By similarity | |||||||||
| Disulfide bond | 38 ↔ 51 | Alternate By similarity | |||||||||
| Disulfide bond | 38 ↔ 40 | Alternate By similarity | |||||||||
| Disulfide bond | 44 ↔ 50 | By similarity | |||||||||
| Disulfide bond | 51 ↔ 58 | Alternate By similarity | |||||||||
| Disulfide bond | 90 ↔ 106 | Alternate By similarity | |||||||||
| Disulfide bond | 90 ↔ 94 | Alternate By similarity | |||||||||
| Disulfide bond | 94 ↔ 124 | Alternate By similarity | |||||||||
| Disulfide bond | 104 ↔ 117 | Alternate By similarity | |||||||||
| Disulfide bond | 104 ↔ 106 | Alternate By similarity | |||||||||
| Disulfide bond | 110 ↔ 116 | By similarity | |||||||||
| Disulfide bond | 117 ↔ 124 | Alternate By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 19 – 82 | 64 | GKIES…ALASN → D in isoform 3. | VSP_039215 | |||||||
| Alternative sequence | 19 – 59 | 41 | Missing in isoform 2. | VSP_039216 | |||||||
| Natural variant | 72 | 1 | E → Q. Corresponds to variant rs6504 [ dbSNP | Ensembl ]. | VAR_014793 | |||||||
| Natural variant | 72 | 1 | E → V. Corresponds to variant rs6505 [ dbSNP | Ensembl ]. | VAR_014794 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 284 | 1 | E → Q: Abolishes endoribonuclease activity and increases RNA-binding activity. Ref.7 | ||||||||
| Mutagenesis | 285 | 1 | H → A: Abolishes endoribonuclease activity without affecting RNA-binding activity. Ref.7 | ||||||||
| Mutagenesis | 290 | 1 | E → Q: Abolishes endoribonuclease activity without affecting RNA-binding activity. Ref.7 | ||||||||
| Mutagenesis | 300 | 1 | H → A: Abolishes endoribonuclease activity without affecting RNA-binding activity. Ref.7 | ||||||||
| Mutagenesis | 343 | 1 | K → A: Strongly impairs endoribonuclease activity without affecting RNA-binding activity. Ref.7 | ||||||||
| Sequence conflict | 123 | 1 | L → P in BAG37240. Ref.2 | ||||||||
| Sequence conflict | 387 | 1 | Y → H in BAG37240. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of a cDNA encoding human placental protein 11, a putative serine protease with diagnostic significance as a tumor marker." Grundmann U., Roemisch J., Siebold B., Bohn H., Amann E. DNA Cell Biol. 9:243-250(1990) [PubMed: 2350438] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PROTEIN SEQUENCE OF N-TERMINUS. Tissue: Placenta. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Placenta. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [6] | "Homology of placental protein 11 and pea seed albumin 2 with vitronectin." Jenne D.E. Biochem. Biophys. Res. Commun. 176:1000-1006(1991) [PubMed: 1710108] [Abstract] Cited for: DOMAIN SOMATOMEDIN-B. |
| [7] | "The tumor marker human placental protein 11 is an endoribonuclease." Laneve P., Gioia U., Ragno R., Altieri F., Di Franco C., Santini T., Arceci M., Bozzoni I., Caffarelli E. J. Biol. Chem. 283:34712-34719(2008) [PubMed: 18936097] [Abstract] Cited for: FUNCTION, RNA-BINDING, COFACTOR, MUTAGENESIS OF GLU-284; HIS-285; GLU-290; HIS-300 AND LYS-343. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M32402 mRNA. Translation: AAA36464.1. M36109 mRNA. Translation: AAA36465.1. AK075446 mRNA. Translation: BAG52139.1. AK300169 mRNA. Translation: BAH13227.1. AK314688 mRNA. Translation: BAG37240.1. AC004241 Genomic DNA. No translation available. CH471111 Genomic DNA. Translation: EAW57940.1. BC069715 mRNA. Translation: AAH69715.1. BC074763 mRNA. Translation: AAH74763.1. BC111782 mRNA. Translation: AAI11783.1. |
| IPI | IPI00006995. IPI00795429. IPI00956135. |
| PIR | A34614. |
| RefSeq | NP_001165910.1. NM_001172439.1. NP_001165911.1. NM_001172440.1. NP_006016.1. NM_006025.3. |
| UniGene | Hs.997. |
3D structure databases | |
| ProteinModelPortal | P21128. |
| SMR | P21128. Positions 17-408. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P21128. |
Polymorphism databases | |
| DMDM | 296434493. |
Proteomic databases | |
| PRIDE | P21128. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000229003; ENSP00000229003; ENSG00000111405. ENST00000422538; ENSP00000397679; ENSG00000111405. |
| GeneID | 8909. |
| KEGG | hsa:8909. |
| UCSC | uc001rpt.1. human. |
Organism-specific databases | |
| CTD | 8909. |
| GeneCards | GC12M048103. |
| H-InvDB | HIX0036755. |
| HGNC | HGNC:14369. ENDOU. |
| HPA | HPA012388. |
| MIM | 606720. gene. |
| neXtProt | NX_P21128. |
| PharmGKB | PA165512645. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05621. |
| GeneTree | ENSGT00530000063825. |
| HOVERGEN | HBG008236. |
| InParanoid | P21128. |
| OMA | RCQEFGN. |
| OrthoDB | EOG4V6ZH0. |
| PhylomeDB | P21128. |
Gene expression databases | |
| ArrayExpress | P21128. |
| Bgee | P21128. |
| Genevestigator | P21128. |
| GermOnline | ENSG00000111405. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018998. Endoribonuclease_XendoU. IPR020436. Somatomedin_B_chordata. IPR001212. Somatomedin_B_dom. [Graphical view] |
| KO | K14648. |
| Pfam | PF01033. Somatomedin_B. 2 hits. PF09412. XendoU. 1 hit. [Graphical view] |
| PRINTS | PR00022. SOMATOMEDINB. |
| SMART | SM00201. SO. 2 hits. [Graphical view] |
| PROSITE | PS00524. SMB_1. 2 hits. PS50958. SMB_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 33477. |
| SOURCE | Search... |
Entry information
| Entry name | ENDOU_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P21128 Secondary accession number(s): B2RBJ3 Q2NKJ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with