SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P20941

- PHOS_HUMAN

UniProt

P20941 - PHOS_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosducin

Gene
PDC
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. Inhibits the transcriptional activation activity of the cone-rod homeobox CRX.1 Publication

GO - Molecular functioni

  1. phospholipase inhibitor activity Source: ProtInc

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: ProtInc
  2. negative regulation of catalytic activity Source: GOC
  3. phototransduction Source: ProtInc
  4. visual perception Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Sensory transduction, Vision

Enzyme and pathway databases

SignaLinkiP20941.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosducin
Short name:
PHD
Alternative name(s):
33 kDa phototransducing protein
Protein MEKA
Gene namesi
Name:PDC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:8759. PDC.

Subcellular locationi

Cytoplasmcytosol. Cell projectionciliumphotoreceptor outer segment. Photoreceptor inner segment. Nucleus
Note: Outer and inner segments of the rod cells.1 Publication
Isoform 2 : Nucleus 1 Publication

GO - Cellular componenti

  1. cytosol Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
  3. photoreceptor inner segment Source: UniProtKB-SubCell
  4. photoreceptor outer segment Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33109.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 246246PhosducinPRO_0000163752Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei73 – 731Phosphoserine; by PKA By similarity

Post-translational modificationi

Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of this protein by cAMP kinase.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP20941.
PRIDEiP20941.

PTM databases

PhosphoSiteiP20941.

Expressioni

Gene expression databases

ArrayExpressiP20941.
BgeeiP20941.
CleanExiHS_PDC.
GenevestigatoriP20941.

Organism-specific databases

HPAiHPA028432.

Interactioni

Subunit structurei

Forms a complex with the beta and gamma subunits of the GTP-binding protein, transducin. Interacts with CRX.1 Publication

Protein-protein interaction databases

BioGridi111159. 3 interactions.
STRINGi9606.ENSP00000375855.

Structurei

3D structure databases

ProteinModelPortaliP20941.
SMRiP20941. Positions 14-230.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni111 – 246136Thioredoxin fold By similarityAdd
BLAST

Sequence similaritiesi

Belongs to the phosducin family.

Phylogenomic databases

eggNOGiNOG262340.
HOGENOMiHOG000232010.
HOVERGENiHBG003456.
InParanoidiP20941.
KOiK08327.
OMAiCMQDMHQ.
OrthoDBiEOG7H4DVC.
PhylomeDBiP20941.
TreeFamiTF315179.

Family and domain databases

Gene3Di1.10.168.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR001200. Phosducin.
IPR023196. Phosducin_N_dom.
IPR024253. Phosducin_thioredoxin-like_dom.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF02114. Phosducin. 1 hit.
[Graphical view]
PRINTSiPR00677. PHOSDUCIN.
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P20941-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEEAKSQSLE EDFEGQATHT GPKGVINDWR KFKLESQDSD SIPPSKKEIL    50
RQMSSPQSRN GKDSKERVSR KMSIQEYELI HKEKEDENCL RKYRRQCMQD 100
MHQKLSFGPR YGFVYELETG KQFLETIEKE LKITTIVVHI YEDGIKGCDA 150
LNSSLTCLAA EYPIVKFCKI KASNTGAGDR FSLDVLPTLL IYKGGELISN 200
FISVAEQFAE EFFAGDVESF LNEYGLLPER EVHVLEHTKI EEEDVE 246
Length:246
Mass (Da):28,246
Last modified:February 1, 1991 - v1
Checksum:iDF59C2C7C3308C90
GO
Isoform 2 (identifier: P20941-2) [UniParc]FASTAAdd to Basket

Also known as: PhLOP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:194
Mass (Da):22,317
Checksum:i228ADD7757825F29
GO
Isoform 3 (identifier: P20941-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPESLDSPTSGRPGVTTHSTRTPGTEIQTIISNPVPKM

Show »
Length:283
Mass (Da):32,118
Checksum:iB9637E3DF21C470D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5252Missing in isoform 2. VSP_043880Add
BLAST
Alternative sequencei1 – 11M → MPESLDSPTSGRPGVTTHST RTPGTEIQTIISNPVPKM in isoform 3. VSP_053778

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti140 – 1401I → L in AAA36210. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M33478 mRNA. Translation: AAA35486.1.
M38059, M60720, M38058 Genomic DNA. Translation: AAA36210.1.
AF076463 mRNA. Translation: AAD43141.1.
AF076464 mRNA. Translation: AAD43142.1.
AL596220 Genomic DNA. Translation: CAI13122.1.
AL663036 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91212.1.
CCDSiCCDS1370.1. [P20941-1]
CCDS41447.1. [P20941-2]
PIRiA35422.
RefSeqiNP_002588.3. NM_002597.4. [P20941-1]
NP_072098.1. NM_022576.3. [P20941-2]
UniGeneiHs.654381.

Genome annotation databases

EnsembliENST00000340129; ENSP00000342033; ENSG00000116703. [P20941-1]
ENST00000391997; ENSP00000375855; ENSG00000116703. [P20941-1]
ENST00000456239; ENSP00000411564; ENSG00000116703. [P20941-2]
ENST00000497198; ENSP00000422775; ENSG00000116703. [P20941-2]
GeneIDi5132.
KEGGihsa:5132.
UCSCiuc001grz.3. human. [P20941-1]

Polymorphism databases

DMDMi130134.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Mutations of the PDC gene

Retina International's Scientific Newsletter

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M33478 mRNA. Translation: AAA35486.1 .
M38059 , M60720 , M38058 Genomic DNA. Translation: AAA36210.1 .
AF076463 mRNA. Translation: AAD43141.1 .
AF076464 mRNA. Translation: AAD43142.1 .
AL596220 Genomic DNA. Translation: CAI13122.1 .
AL663036 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91212.1 .
CCDSi CCDS1370.1. [P20941-1 ]
CCDS41447.1. [P20941-2 ]
PIRi A35422.
RefSeqi NP_002588.3. NM_002597.4. [P20941-1 ]
NP_072098.1. NM_022576.3. [P20941-2 ]
UniGenei Hs.654381.

3D structure databases

ProteinModelPortali P20941.
SMRi P20941. Positions 14-230.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111159. 3 interactions.
STRINGi 9606.ENSP00000375855.

PTM databases

PhosphoSitei P20941.

Polymorphism databases

DMDMi 130134.

Proteomic databases

PaxDbi P20941.
PRIDEi P20941.

Protocols and materials databases

DNASUi 5132.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340129 ; ENSP00000342033 ; ENSG00000116703 . [P20941-1 ]
ENST00000391997 ; ENSP00000375855 ; ENSG00000116703 . [P20941-1 ]
ENST00000456239 ; ENSP00000411564 ; ENSG00000116703 . [P20941-2 ]
ENST00000497198 ; ENSP00000422775 ; ENSG00000116703 . [P20941-2 ]
GeneIDi 5132.
KEGGi hsa:5132.
UCSCi uc001grz.3. human. [P20941-1 ]

Organism-specific databases

CTDi 5132.
GeneCardsi GC01M186412.
HGNCi HGNC:8759. PDC.
HPAi HPA028432.
MIMi 171490. gene.
neXtProti NX_P20941.
PharmGKBi PA33109.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG262340.
HOGENOMi HOG000232010.
HOVERGENi HBG003456.
InParanoidi P20941.
KOi K08327.
OMAi CMQDMHQ.
OrthoDBi EOG7H4DVC.
PhylomeDBi P20941.
TreeFami TF315179.

Enzyme and pathway databases

SignaLinki P20941.

Miscellaneous databases

GeneWikii Phosducin.
GenomeRNAii 5132.
NextBioi 19786.
PROi P20941.
SOURCEi Search...

Gene expression databases

ArrayExpressi P20941.
Bgeei P20941.
CleanExi HS_PDC.
Genevestigatori P20941.

Family and domain databases

Gene3Di 1.10.168.10. 1 hit.
3.40.30.10. 1 hit.
InterProi IPR001200. Phosducin.
IPR023196. Phosducin_N_dom.
IPR024253. Phosducin_thioredoxin-like_dom.
IPR012336. Thioredoxin-like_fold.
[Graphical view ]
Pfami PF02114. Phosducin. 1 hit.
[Graphical view ]
PRINTSi PR00677. PHOSDUCIN.
SUPFAMi SSF52833. SSF52833. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Analysis of the human, bovine and rat 33-kDa proteins and cDNA in retina and pineal gland."
    Abe T., Nakabayashi H., Tamada H., Takagi T., Sakuragi S., Yamaki K., Shinohara T.
    Gene 91:209-215(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Pineal gland and Retina.
  2. "Isolation and analysis of the human MEKA gene encoding a retina-specific protein."
    Watanabe Y., Kawasaki K., Miki N., Kuo C.H.
    Biochem. Biophys. Res. Commun. 170:951-956(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Modulation of CRX transactivation activity by phosducin isoforms."
    Zhu X., Craft C.M.
    Mol. Cell. Biol. 20:5216-5226(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, INTERACTION WITH CRX, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
    Tissue: Retina.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiPHOS_HUMAN
AccessioniPrimary (citable) accession number: P20941
Secondary accession number(s): Q14816, Q9UP22, Q9UP23
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi