Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P20941

- PHOS_HUMAN

UniProt

P20941 - PHOS_HUMAN

Protein

Phosducin

Gene

PDC

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 1 (01 Feb 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. Inhibits the transcriptional activation activity of the cone-rod homeobox CRX.1 Publication

    GO - Molecular functioni

    1. phospholipase inhibitor activity Source: ProtInc

    GO - Biological processi

    1. G-protein coupled receptor signaling pathway Source: ProtInc
    2. negative regulation of catalytic activity Source: GOC
    3. phototransduction Source: ProtInc
    4. visual perception Source: UniProtKB-KW

    Keywords - Biological processi

    Sensory transduction, Vision

    Enzyme and pathway databases

    SignaLinkiP20941.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phosducin
    Short name:
    PHD
    Alternative name(s):
    33 kDa phototransducing protein
    Protein MEKA
    Gene namesi
    Name:PDC
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:8759. PDC.

    Subcellular locationi

    Cytoplasmcytosol 1 Publication. Cell projectionciliumphotoreceptor outer segment 1 Publication. Photoreceptor inner segment 1 Publication. Nucleus 1 Publication
    Note: Outer and inner segments of the rod cells.

    GO - Cellular componenti

    1. cytosol Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell
    3. photoreceptor inner segment Source: UniProtKB-SubCell
    4. photoreceptor outer segment Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell projection, Cilium, Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33109.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 246246PhosducinPRO_0000163752Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei73 – 731Phosphoserine; by PKABy similarity

    Post-translational modificationi

    Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of this protein by cAMP kinase.

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP20941.
    PRIDEiP20941.

    PTM databases

    PhosphoSiteiP20941.

    Expressioni

    Gene expression databases

    ArrayExpressiP20941.
    BgeeiP20941.
    CleanExiHS_PDC.
    GenevestigatoriP20941.

    Organism-specific databases

    HPAiHPA028432.

    Interactioni

    Subunit structurei

    Forms a complex with the beta and gamma subunits of the GTP-binding protein, transducin. Interacts with CRX.1 Publication

    Protein-protein interaction databases

    BioGridi111159. 3 interactions.
    STRINGi9606.ENSP00000375855.

    Structurei

    3D structure databases

    ProteinModelPortaliP20941.
    SMRiP20941. Positions 14-230.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni111 – 246136Thioredoxin foldBy similarityAdd
    BLAST

    Sequence similaritiesi

    Belongs to the phosducin family.Curated

    Phylogenomic databases

    eggNOGiNOG262340.
    HOGENOMiHOG000232010.
    HOVERGENiHBG003456.
    InParanoidiP20941.
    KOiK08327.
    OMAiCMQDMHQ.
    OrthoDBiEOG7H4DVC.
    PhylomeDBiP20941.
    TreeFamiTF315179.

    Family and domain databases

    Gene3Di1.10.168.10. 1 hit.
    3.40.30.10. 1 hit.
    InterProiIPR001200. Phosducin.
    IPR023196. Phosducin_N_dom.
    IPR024253. Phosducin_thioredoxin-like_dom.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view]
    PfamiPF02114. Phosducin. 1 hit.
    [Graphical view]
    PRINTSiPR00677. PHOSDUCIN.
    SUPFAMiSSF52833. SSF52833. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P20941-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEAKSQSLE EDFEGQATHT GPKGVINDWR KFKLESQDSD SIPPSKKEIL    50
    RQMSSPQSRN GKDSKERVSR KMSIQEYELI HKEKEDENCL RKYRRQCMQD 100
    MHQKLSFGPR YGFVYELETG KQFLETIEKE LKITTIVVHI YEDGIKGCDA 150
    LNSSLTCLAA EYPIVKFCKI KASNTGAGDR FSLDVLPTLL IYKGGELISN 200
    FISVAEQFAE EFFAGDVESF LNEYGLLPER EVHVLEHTKI EEEDVE 246
    Length:246
    Mass (Da):28,246
    Last modified:February 1, 1991 - v1
    Checksum:iDF59C2C7C3308C90
    GO
    Isoform 2 (identifier: P20941-2) [UniParc]FASTAAdd to Basket

    Also known as: PhLOP1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: Missing.

    Show »
    Length:194
    Mass (Da):22,317
    Checksum:i228ADD7757825F29
    GO
    Isoform 3 (identifier: P20941-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPESLDSPTSGRPGVTTHSTRTPGTEIQTIISNPVPKM

    Show »
    Length:283
    Mass (Da):32,118
    Checksum:iB9637E3DF21C470D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti140 – 1401I → L in AAA36210. (PubMed:2383274)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5252Missing in isoform 2. 1 PublicationVSP_043880Add
    BLAST
    Alternative sequencei1 – 11M → MPESLDSPTSGRPGVTTHST RTPGTEIQTIISNPVPKM in isoform 3. 1 PublicationVSP_053778

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M33478 mRNA. Translation: AAA35486.1.
    M38059, M60720, M38058 Genomic DNA. Translation: AAA36210.1.
    AF076463 mRNA. Translation: AAD43141.1.
    AF076464 mRNA. Translation: AAD43142.1.
    AL596220 Genomic DNA. Translation: CAI13122.1.
    AL663036 Genomic DNA. No translation available.
    CH471067 Genomic DNA. Translation: EAW91212.1.
    CCDSiCCDS1370.1. [P20941-1]
    CCDS41447.1. [P20941-2]
    PIRiA35422.
    RefSeqiNP_002588.3. NM_002597.4. [P20941-1]
    NP_072098.1. NM_022576.3. [P20941-2]
    UniGeneiHs.654381.

    Genome annotation databases

    EnsembliENST00000391997; ENSP00000375855; ENSG00000116703. [P20941-1]
    ENST00000497198; ENSP00000422775; ENSG00000116703. [P20941-2]
    GeneIDi5132.
    KEGGihsa:5132.
    UCSCiuc001grz.3. human. [P20941-1]

    Polymorphism databases

    DMDMi130134.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Mutations of the PDC gene

    Retina International's Scientific Newsletter

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M33478 mRNA. Translation: AAA35486.1 .
    M38059 , M60720 , M38058 Genomic DNA. Translation: AAA36210.1 .
    AF076463 mRNA. Translation: AAD43141.1 .
    AF076464 mRNA. Translation: AAD43142.1 .
    AL596220 Genomic DNA. Translation: CAI13122.1 .
    AL663036 Genomic DNA. No translation available.
    CH471067 Genomic DNA. Translation: EAW91212.1 .
    CCDSi CCDS1370.1. [P20941-1 ]
    CCDS41447.1. [P20941-2 ]
    PIRi A35422.
    RefSeqi NP_002588.3. NM_002597.4. [P20941-1 ]
    NP_072098.1. NM_022576.3. [P20941-2 ]
    UniGenei Hs.654381.

    3D structure databases

    ProteinModelPortali P20941.
    SMRi P20941. Positions 14-230.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111159. 3 interactions.
    STRINGi 9606.ENSP00000375855.

    PTM databases

    PhosphoSitei P20941.

    Polymorphism databases

    DMDMi 130134.

    Proteomic databases

    PaxDbi P20941.
    PRIDEi P20941.

    Protocols and materials databases

    DNASUi 5132.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000391997 ; ENSP00000375855 ; ENSG00000116703 . [P20941-1 ]
    ENST00000497198 ; ENSP00000422775 ; ENSG00000116703 . [P20941-2 ]
    GeneIDi 5132.
    KEGGi hsa:5132.
    UCSCi uc001grz.3. human. [P20941-1 ]

    Organism-specific databases

    CTDi 5132.
    GeneCardsi GC01M186412.
    HGNCi HGNC:8759. PDC.
    HPAi HPA028432.
    MIMi 171490. gene.
    neXtProti NX_P20941.
    PharmGKBi PA33109.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG262340.
    HOGENOMi HOG000232010.
    HOVERGENi HBG003456.
    InParanoidi P20941.
    KOi K08327.
    OMAi CMQDMHQ.
    OrthoDBi EOG7H4DVC.
    PhylomeDBi P20941.
    TreeFami TF315179.

    Enzyme and pathway databases

    SignaLinki P20941.

    Miscellaneous databases

    GeneWikii Phosducin.
    GenomeRNAii 5132.
    NextBioi 19786.
    PROi P20941.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P20941.
    Bgeei P20941.
    CleanExi HS_PDC.
    Genevestigatori P20941.

    Family and domain databases

    Gene3Di 1.10.168.10. 1 hit.
    3.40.30.10. 1 hit.
    InterProi IPR001200. Phosducin.
    IPR023196. Phosducin_N_dom.
    IPR024253. Phosducin_thioredoxin-like_dom.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view ]
    Pfami PF02114. Phosducin. 1 hit.
    [Graphical view ]
    PRINTSi PR00677. PHOSDUCIN.
    SUPFAMi SSF52833. SSF52833. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Analysis of the human, bovine and rat 33-kDa proteins and cDNA in retina and pineal gland."
      Abe T., Nakabayashi H., Tamada H., Takagi T., Sakuragi S., Yamaki K., Shinohara T.
      Gene 91:209-215(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Pineal gland and Retina.
    2. "Isolation and analysis of the human MEKA gene encoding a retina-specific protein."
      Watanabe Y., Kawasaki K., Miki N., Kuo C.H.
      Biochem. Biophys. Res. Commun. 170:951-956(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Modulation of CRX transactivation activity by phosducin isoforms."
      Zhu X., Craft C.M.
      Mol. Cell. Biol. 20:5216-5226(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, INTERACTION WITH CRX, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
      Tissue: Retina.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiPHOS_HUMAN
    AccessioniPrimary (citable) accession number: P20941
    Secondary accession number(s): Q14816, Q9UP22, Q9UP23
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1991
    Last sequence update: February 1, 1991
    Last modified: October 1, 2014
    This is version 129 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3