Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosducin

Gene

PDC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. Inhibits the transcriptional activation activity of the cone-rod homeobox CRX.1 Publication

GO - Molecular functioni

  • phospholipase inhibitor activity Source: ProtInc

GO - Biological processi

  • G-protein coupled receptor signaling pathway Source: ProtInc
  • phototransduction Source: ProtInc
  • queuosine biosynthetic process Source: GO_Central
  • visual perception Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Sensory transduction, Vision

Enzyme and pathway databases

BioCyciZFISH:ENSG00000116703-MONOMER.
SignaLinkiP20941.
SIGNORiP20941.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosducin
Short name:
PHD
Alternative name(s):
33 kDa phototransducing protein
Protein MEKA
Gene namesi
Name:PDC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:8759. PDC.

Subcellular locationi

  • Cytoplasmcytosol 1 Publication
  • Nucleus 1 Publication
  • Cell projectionciliumphotoreceptor outer segment By similarity
  • Photoreceptor inner segment By similarity
Isoform 2 :
  • Nucleus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5132.
MalaCardsiPDC.
OpenTargetsiENSG00000116703.
PharmGKBiPA33109.

Polymorphism and mutation databases

BioMutaiPDC.
DMDMi130134.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001637521 – 246PhosducinAdd BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei73Phosphoserine; by PKABy similarity1

Post-translational modificationi

Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of this protein by cAMP kinase.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP20941.
PeptideAtlasiP20941.
PRIDEiP20941.

PTM databases

iPTMnetiP20941.
PhosphoSitePlusiP20941.

Expressioni

Gene expression databases

BgeeiENSG00000116703.
CleanExiHS_PDC.
ExpressionAtlasiP20941. baseline and differential.
GenevisibleiP20941. HS.

Organism-specific databases

HPAiHPA028432.

Interactioni

Subunit structurei

Forms a complex with the beta and gamma subunits of the GTP-binding protein, transducin. Interacts with CRX.1 Publication

Protein-protein interaction databases

BioGridi111159. 2 interactors.
STRINGi9606.ENSP00000342033.

Structurei

3D structure databases

ProteinModelPortaliP20941.
SMRiP20941.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni111 – 246Thioredoxin foldBy similarityAdd BLAST136

Sequence similaritiesi

Belongs to the phosducin family.Curated

Phylogenomic databases

eggNOGiKOG3171. Eukaryota.
ENOG4110DRD. LUCA.
GeneTreeiENSGT00530000062970.
HOGENOMiHOG000232010.
HOVERGENiHBG003456.
InParanoidiP20941.
KOiK08327.
OMAiCMQDMHQ.
OrthoDBiEOG091G0ISM.
PhylomeDBiP20941.
TreeFamiTF315179.

Family and domain databases

Gene3Di1.10.168.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR001200. Phosducin.
IPR023196. Phosducin_N_dom.
IPR024253. Phosducin_thioredoxin-like_dom.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF02114. Phosducin. 1 hit.
[Graphical view]
PRINTSiPR00677. PHOSDUCIN.
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P20941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEAKSQSLE EDFEGQATHT GPKGVINDWR KFKLESQDSD SIPPSKKEIL
60 70 80 90 100
RQMSSPQSRN GKDSKERVSR KMSIQEYELI HKEKEDENCL RKYRRQCMQD
110 120 130 140 150
MHQKLSFGPR YGFVYELETG KQFLETIEKE LKITTIVVHI YEDGIKGCDA
160 170 180 190 200
LNSSLTCLAA EYPIVKFCKI KASNTGAGDR FSLDVLPTLL IYKGGELISN
210 220 230 240
FISVAEQFAE EFFAGDVESF LNEYGLLPER EVHVLEHTKI EEEDVE
Length:246
Mass (Da):28,246
Last modified:February 1, 1991 - v1
Checksum:iDF59C2C7C3308C90
GO
Isoform 2 (identifier: P20941-2) [UniParc]FASTAAdd to basket
Also known as: PhLOP1

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:194
Mass (Da):22,317
Checksum:i228ADD7757825F29
GO
Isoform 3 (identifier: P20941-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPESLDSPTSGRPGVTTHSTRTPGTEIQTIISNPVPKM

Show »
Length:283
Mass (Da):32,118
Checksum:iB9637E3DF21C470D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti140I → L in AAA36210 (PubMed:2383274).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0438801 – 52Missing in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_0537781M → MPESLDSPTSGRPGVTTHST RTPGTEIQTIISNPVPKM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33478 mRNA. Translation: AAA35486.1.
M38059, M60720, M38058 Genomic DNA. Translation: AAA36210.1.
AF076463 mRNA. Translation: AAD43141.1.
AF076464 mRNA. Translation: AAD43142.1.
AL596220 Genomic DNA. Translation: CAI13122.1.
AL663036 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91212.1.
CCDSiCCDS1370.1. [P20941-1]
CCDS41447.1. [P20941-2]
PIRiA35422.
RefSeqiNP_002588.3. NM_002597.4. [P20941-1]
NP_072098.1. NM_022576.3. [P20941-2]
XP_011507905.1. XM_011509603.2. [P20941-1]
UniGeneiHs.654381.

Genome annotation databases

EnsembliENST00000391997; ENSP00000375855; ENSG00000116703. [P20941-1]
ENST00000497198; ENSP00000422775; ENSG00000116703. [P20941-2]
GeneIDi5132.
KEGGihsa:5132.
UCSCiuc001grz.4. human. [P20941-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Mutations of the PDC gene

Retina International's Scientific Newsletter

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33478 mRNA. Translation: AAA35486.1.
M38059, M60720, M38058 Genomic DNA. Translation: AAA36210.1.
AF076463 mRNA. Translation: AAD43141.1.
AF076464 mRNA. Translation: AAD43142.1.
AL596220 Genomic DNA. Translation: CAI13122.1.
AL663036 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91212.1.
CCDSiCCDS1370.1. [P20941-1]
CCDS41447.1. [P20941-2]
PIRiA35422.
RefSeqiNP_002588.3. NM_002597.4. [P20941-1]
NP_072098.1. NM_022576.3. [P20941-2]
XP_011507905.1. XM_011509603.2. [P20941-1]
UniGeneiHs.654381.

3D structure databases

ProteinModelPortaliP20941.
SMRiP20941.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111159. 2 interactors.
STRINGi9606.ENSP00000342033.

PTM databases

iPTMnetiP20941.
PhosphoSitePlusiP20941.

Polymorphism and mutation databases

BioMutaiPDC.
DMDMi130134.

Proteomic databases

PaxDbiP20941.
PeptideAtlasiP20941.
PRIDEiP20941.

Protocols and materials databases

DNASUi5132.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000391997; ENSP00000375855; ENSG00000116703. [P20941-1]
ENST00000497198; ENSP00000422775; ENSG00000116703. [P20941-2]
GeneIDi5132.
KEGGihsa:5132.
UCSCiuc001grz.4. human. [P20941-1]

Organism-specific databases

CTDi5132.
DisGeNETi5132.
GeneCardsiPDC.
HGNCiHGNC:8759. PDC.
HPAiHPA028432.
MalaCardsiPDC.
MIMi171490. gene.
neXtProtiNX_P20941.
OpenTargetsiENSG00000116703.
PharmGKBiPA33109.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3171. Eukaryota.
ENOG4110DRD. LUCA.
GeneTreeiENSGT00530000062970.
HOGENOMiHOG000232010.
HOVERGENiHBG003456.
InParanoidiP20941.
KOiK08327.
OMAiCMQDMHQ.
OrthoDBiEOG091G0ISM.
PhylomeDBiP20941.
TreeFamiTF315179.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000116703-MONOMER.
SignaLinkiP20941.
SIGNORiP20941.

Miscellaneous databases

GeneWikiiPhosducin.
GenomeRNAii5132.
PROiP20941.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000116703.
CleanExiHS_PDC.
ExpressionAtlasiP20941. baseline and differential.
GenevisibleiP20941. HS.

Family and domain databases

Gene3Di1.10.168.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR001200. Phosducin.
IPR023196. Phosducin_N_dom.
IPR024253. Phosducin_thioredoxin-like_dom.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF02114. Phosducin. 1 hit.
[Graphical view]
PRINTSiPR00677. PHOSDUCIN.
SUPFAMiSSF52833. SSF52833. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPHOS_HUMAN
AccessioniPrimary (citable) accession number: P20941
Secondary accession number(s): Q14816, Q9UP22, Q9UP23
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 2, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.