Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P20941 (PHOS_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phosducin

Short name=PHD
Alternative name(s):
33 kDa phototransducing protein
Protein MEKA
Gene names
Name:PDC
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length246 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism. Inhibits the transcriptional activation activity of the cone-rod homeobox CRX. Ref.3

Subunit structure

Forms a complex with the beta and gamma subunits of the GTP-binding protein, transducin. Interacts with CRX. Ref.3

Subcellular location

Cytoplasmcytosol. Cell projectionciliumphotoreceptor outer segment. Photoreceptor inner segment. Nucleus. Note: Outer and inner segments of the rod cells. Ref.3

Isoform 2: Nucleus Ref.3.

Post-translational modification

Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of this protein by cAMP kinase.

Sequence similarities

Belongs to the phosducin family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P20941-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P20941-2)

Also known as: PhLOP1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
Isoform 3 (identifier: P20941-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPESLDSPTSGRPGVTTHSTRTPGTEIQTIISNPVPKM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 246246Phosducin
PRO_0000163752

Regions

Region111 – 246136Thioredoxin fold By similarity

Amino acid modifications

Modified residue731Phosphoserine; by PKA By similarity

Natural variations

Alternative sequence1 – 5252Missing in isoform 2.
VSP_043880
Alternative sequence11M → MPESLDSPTSGRPGVTTHST RTPGTEIQTIISNPVPKM in isoform 3.
VSP_053778

Experimental info

Sequence conflict1401I → L in AAA36210. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1991. Version 1.
Checksum: DF59C2C7C3308C90

FASTA24628,246
        10         20         30         40         50         60 
MEEAKSQSLE EDFEGQATHT GPKGVINDWR KFKLESQDSD SIPPSKKEIL RQMSSPQSRN 

        70         80         90        100        110        120 
GKDSKERVSR KMSIQEYELI HKEKEDENCL RKYRRQCMQD MHQKLSFGPR YGFVYELETG 

       130        140        150        160        170        180 
KQFLETIEKE LKITTIVVHI YEDGIKGCDA LNSSLTCLAA EYPIVKFCKI KASNTGAGDR 

       190        200        210        220        230        240 
FSLDVLPTLL IYKGGELISN FISVAEQFAE EFFAGDVESF LNEYGLLPER EVHVLEHTKI 


EEEDVE 

« Hide

Isoform 2 (PhLOP1) [UniParc].

Checksum: 228ADD7757825F29
Show »

FASTA19422,317
Isoform 3 [UniParc].

Checksum: B9637E3DF21C470D
Show »

FASTA28332,118

References

« Hide 'large scale' references
[1]"Analysis of the human, bovine and rat 33-kDa proteins and cDNA in retina and pineal gland."
Abe T., Nakabayashi H., Tamada H., Takagi T., Sakuragi S., Yamaki K., Shinohara T.
Gene 91:209-215(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Pineal gland and Retina.
[2]"Isolation and analysis of the human MEKA gene encoding a retina-specific protein."
Watanabe Y., Kawasaki K., Miki N., Kuo C.H.
Biochem. Biophys. Res. Commun. 170:951-956(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"Modulation of CRX transactivation activity by phosducin isoforms."
Zhu X., Craft C.M.
Mol. Cell. Biol. 20:5216-5226(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, INTERACTION WITH CRX, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
Tissue: Retina.
[4]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Web resources

Mutations of the PDC gene

Retina International's Scientific Newsletter

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M33478 mRNA. Translation: AAA35486.1.
M38059, M60720, M38058 Genomic DNA. Translation: AAA36210.1.
AF076463 mRNA. Translation: AAD43141.1.
AF076464 mRNA. Translation: AAD43142.1.
AL596220 Genomic DNA. Translation: CAI13122.1.
AL663036 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91212.1.
CCDSCCDS1370.1. [P20941-1]
CCDS41447.1. [P20941-2]
PIRA35422.
RefSeqNP_002588.3. NM_002597.4. [P20941-1]
NP_072098.1. NM_022576.3. [P20941-2]
UniGeneHs.654381.

3D structure databases

ProteinModelPortalP20941.
SMRP20941. Positions 14-230.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111159. 3 interactions.
STRING9606.ENSP00000375855.

PTM databases

PhosphoSiteP20941.

Polymorphism databases

DMDM130134.

Proteomic databases

PaxDbP20941.
PRIDEP20941.

Protocols and materials databases

DNASU5132.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000340129; ENSP00000342033; ENSG00000116703. [P20941-1]
ENST00000391997; ENSP00000375855; ENSG00000116703. [P20941-1]
ENST00000456239; ENSP00000411564; ENSG00000116703. [P20941-2]
ENST00000497198; ENSP00000422775; ENSG00000116703. [P20941-2]
GeneID5132.
KEGGhsa:5132.
UCSCuc001grz.3. human. [P20941-1]

Organism-specific databases

CTD5132.
GeneCardsGC01M186412.
HGNCHGNC:8759. PDC.
HPAHPA028432.
MIM171490. gene.
neXtProtNX_P20941.
PharmGKBPA33109.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG262340.
HOGENOMHOG000232010.
HOVERGENHBG003456.
InParanoidP20941.
KOK08327.
OMACMQDMHQ.
OrthoDBEOG7H4DVC.
PhylomeDBP20941.
TreeFamTF315179.

Enzyme and pathway databases

SignaLinkP20941.

Gene expression databases

ArrayExpressP20941.
BgeeP20941.
CleanExHS_PDC.
GenevestigatorP20941.

Family and domain databases

Gene3D1.10.168.10. 1 hit.
3.40.30.10. 1 hit.
InterProIPR001200. Phosducin.
IPR023196. Phosducin_N_dom.
IPR024253. Phosducin_thioredoxin-like_dom.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamPF02114. Phosducin. 1 hit.
[Graphical view]
PRINTSPR00677. PHOSDUCIN.
SUPFAMSSF52833. SSF52833. 1 hit.
ProtoNetSearch...

Other

GeneWikiPhosducin.
GenomeRNAi5132.
NextBio19786.
PROP20941.
SOURCESearch...

Entry information

Entry namePHOS_HUMAN
AccessionPrimary (citable) accession number: P20941
Secondary accession number(s): Q14816, Q9UP22, Q9UP23
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM