P20839 (IMDH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 164.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inosine-5'-monophosphate dehydrogenase 1 Short name=IMP dehydrogenase 1 Short name=IMPD 1 Short name=IMPDH 1 EC=1.1.1.205 Alternative name(s): IMPDH-I | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 514 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors. HAMAP-Rule MF_03156 |
| Catalytic activity | Inosine 5'-phosphate + NAD+ + H2O = xanthosine 5'-phosphate + NADH. HAMAP-Rule MF_03156 |
| Cofactor | Potassium By similarity. |
| Enzyme regulation | Mycophenolic acid (MPA) is a non-competitive inhibitor that prevents formation of the closed enzyme conformation by binding to the same site as the amobile flap. In contrast, mizoribine monophosphate (MZP) is a competitive inhibitor that induces the closed conformation. MPA is a potent inhibitor of mammalian IMPDHs but a poor inhibitor of the bacterial enzymes. MZP is a more potent inhibitor of bacterial IMPDH. Subject to product inhibition by XMP and NADH. Also inhibited by ADP. Ref.6 |
| Pathway | Purine metabolism; XMP biosynthesis via de novo pathway; XMP from IMP: step 1/1. HAMAP-Rule MF_03156 |
| Subunit structure | Homotetramer. Ref.6 |
| Subcellular location | |
| Tissue specificity | IMP type I is the main species in normal leukocytes and type II predominates over type I in the tumor. |
| Induction | Constitutively expressed. Ref.6 |
| Involvement in disease | Retinitis pigmentosa 10 (RP10) [MIM:180105]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. Leber congenital amaurosis 11 (LCA11) [MIM:613837]: A severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus. |
| Miscellaneous | Because IMPDH activity is tightly linked with cell proliferation, it has been recognized as a target for cancer and viral chemotherapy and as a target for immunosuppressive drugs. The activities of the antitumor drug tiazofurin, the antiviral drug ribavirin, and the immunosuppressive drugs mizoribine and mycophenolic acid (MPA) are attributed to the inhibition of IMPDH. In addition, bacterial and parasitic IMPDH's differ significantly from mammalian enzymes, which makes it a suitable target for anti-infective drugs. HAMAP-Rule MF_03156 |
| Sequence similarities | Belongs to the IMPDH/GMPR family. Contains 2 CBS domains. |
| Biophysicochemical properties | Kinetic parameters: KM=18 µM for Inosine 5'-phosphate Ref.6 Ref.7 KM=46 µM for NAD+ |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P20839-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P20839-2) The sequence of this isoform differs from the canonical sequence as follows: 84-108: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P20839-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESM | ||||||
| Isoform 4 (identifier: P20839-4) The sequence of this isoform differs from the canonical sequence as follows: 104-108: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 514 | 513 | Inosine-5'-monophosphate dehydrogenase 1 HAMAP-Rule MF_03156 | PRO_0000093670 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 114 – 173 | 60 | CBS 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 179 – 237 | 59 | CBS 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 274 – 276 | 3 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 324 – 326 | 3 | NAD By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 364 – 366 | 3 | IMP binding HAMAP-Rule MF_03156 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 387 – 388 | 2 | IMP binding HAMAP-Rule MF_03156 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 411 – 415 | 5 | IMP binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 331 | 1 | Thioimidate intermediate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 326 | 1 | Potassium; via carbonyl oxygen By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 328 | 1 | Potassium; via carbonyl oxygen By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 331 | 1 | Potassium; via carbonyl oxygen By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 500 | 1 | Potassium; via carbonyl oxygen; shared with tetrameric partner By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 501 | 1 | Potassium; via carbonyl oxygen; shared with tetrameric partner By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 502 | 1 | Potassium; via carbonyl oxygen; shared with tetrameric partner By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 329 | 1 | IMP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 441 | 1 | IMP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MEGPLTPPPLQGGGAAAVPE PGARQHPGHETAAQRYSARL LQAGYEPESM in isoform 3. | VSP_014363 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 84 – 108 | 25 | Missing in isoform 2. | VSP_002674 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 104 – 108 | 5 | Missing in isoform 4. | VSP_043485 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 105 | 1 | R → W in LCA11; does not alter the enzymatic affinity of the corresponding enzyme; alters the affinity and/or the specificity of single-stranded nucleic acid. Ref.13 | VAR_065616 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 116 | 1 | T → M in RP10; does not alter the enzymatic affinity of the corresponding enzyme; alters the affinity and/or the specificity of single-stranded nucleic acid. Ref.13 | VAR_065617 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 198 | 1 | N → K in LCA11; does not alter the enzymatic affinity of the corresponding enzyme; alters the affinity and/or the specificity of single-stranded nucleic acid. Ref.13 | VAR_065618 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | R → P in RP10. Ref.11 | VAR_017031 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 226 | 1 | D → N in RP10. Ref.12 Ref.13 | VAR_017032 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 268 | 1 | V → I in RP10. Ref.12 Ref.13 | VAR_017033 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 285 | 1 | A → T. Ref.13 | VAR_065619 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 324 | 1 | G → D Does not alter the enzymatic affinity of the corresponding enzyme; does not affect the affinity for single-stranded nucleic acid. Ref.13 | VAR_065620 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 372 | 1 | H → P in RP10; alters the affinity and/or the specificity of single-stranded nucleic acid. Ref.13 | VAR_065621 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 29 | 1 | G → D in AAA36114. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 109 | 1 | K → N in AAA36114. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 273 – 274 | 2 | LD → FH in AAA36114. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 419 | 1 | A → P in AAA36114. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 497 | 1 | A → P in AAA36114. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 14 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 20 – 23 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 26 – 28 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 32 – 34 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 35 – 37 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 46 – 48 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 58 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 63 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 65 – 67 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 71 – 73 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 76 – 84 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 88 – 91 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 97 – 108 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 144 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 160 – 163 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 195 – 199 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 204 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 211 – 216 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 247 – 250 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 256 – 265 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 269 – 273 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 281 – 293 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 298 – 304 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 307 – 316 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 319 – 323 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 343 – 354 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 355 – 357 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 361 – 365 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 378 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 382 – 387 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 388 – 392 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 453 – 471 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 476 – 484 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 492 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two distinct cDNAs for human IMP dehydrogenase." Natsumeda Y., Ohno S., Kawasaki H., Konno Y., Weber G., Suzuki K. J. Biol. Chem. 265:5292-5295(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Spleen. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Blood. |
| [6] | "Characterization of human type I and type II IMP dehydrogenases." Carr S.F., Papp E., Wu J.C., Natsumeda Y. J. Biol. Chem. 268:27286-27290(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-11, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, ENZYME REGULATION. |
| [7] | "Recombinant human inosine monophosphate dehydrogenase type I and type II proteins. Purification and characterization of inhibitor binding." Hager P.W., Collart F.R., Huberman E., Mitchell B.S. Biochem. Pharmacol. 49:1323-1329(1995) [PubMed] [Europe PMC] [Abstract] Cited for: BIOPHYSICOCHEMICAL PROPERTIES. |
| [8] | "Inosine 5'-monophosphate dehydrogenase binds nucleic acids in vitro and in vivo." McLean J.E., Hamaguchi N., Belenky P., Mortimer S.E., Stanton M., Hedstrom L. Biochem. J. 379:243-251(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, NUCLEIC ACID-BINDING. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "Crystal structure of the human type I inosine monophosphate dehydrogenase and implications for isoform specificity." Risal D., Strickler M.D., Goldstein B.M. Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) IN COMPLEX WITH SUBSTRATE ANALOG. |
| [11] | "Identification of an IMPDH1 mutation in autosomal dominant retinitis pigmentosa (RP10) revealed following comparative microarray analysis of transcripts derived from retinas of wild-type and Rho(-/-) mice." Kennan A., Aherne A., Palfi A., Humphries M., McKee A., Stitt A., Simpson D.A., Demtroder K., Orntoft T., Ayuso C., Kenna P.F., Farrar G.J., Humphries P. Hum. Mol. Genet. 11:547-557(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RP10 PRO-224. |
| [12] | "Mutations in the inosine monophosphate dehydrogenase 1 gene (IMPDH1) cause the RP10 form of autosomal dominant retinitis pigmentosa." Bowne S.J., Sullivan L.S., Blanton S.H., Cepko C.L., Blackshaw S., Birch D.G., Hughbanks-Wheaton D., Heckenlively J.R., Daiger S.P. Hum. Mol. Genet. 11:559-568(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RP10 ASN-226 AND ILE-268. |
| [13] | "Spectrum and frequency of mutations in IMPDH1 associated with autosomal dominant retinitis pigmentosa and Leber congenital amaurosis." Bowne S.J., Sullivan L.S., Mortimer S.E., Hedstrom L., Zhu J., Spellicy C.J., Gire A.I., Hughbanks-Wheaton D., Birch D.G., Lewis R.A., Heckenlively J.R., Daiger S.P. Invest. Ophthalmol. Vis. Sci. 47:34-42(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RP10 MET-116; ASN-226; ILE-268 AND PRO-372, VARIANTS LCA11 TRP-105 AND LYS-198, VARIANTS THR-285 AND ASP-324, CHARACTERIZATION OF VARIANTS RP10 MET-116 AND PRO-372, CHARACTERIZATION OF VARIANTS LCA11 TRP-105 AND LYS-198, CHARACTERIZATION OF VARIANT ASP-324. |
| + | Additional computationally mapped references. |
Web resources
| Mutations of the IMPDH1 gene Retina International's Scientific Newsletter |
| GeneReviews |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J05272 mRNA. Translation: AAA36114.1. AK054640 mRNA. Translation: BAB70780.1. AK054667 mRNA. Translation: BAG51409.1. AK293413 mRNA. Translation: BAG56920.1. AC010655 Genomic DNA. No translation available. CH236947 Genomic DNA. Translation: EAL24311.1. BC033622 mRNA. Translation: AAH33622.2. | ||||||||||||
| IPI | IPI00644730. IPI00647813. IPI00916378. IPI00916697. | ||||||||||||
| PIR | A35566. | ||||||||||||
| RefSeq | NP_001096075.1. NM_001102605.1. NP_001136045.1. NM_001142573.1. NP_001136046.1. NM_001142574.1. NP_001136047.1. NM_001142575.1. NP_899066.1. NM_183243.2. | ||||||||||||
| UniGene | Hs.654401. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P20839. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P20839. 3 interactions. | ||||||||||||
| STRING | 9606.ENSP00000345096. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P20839. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 25014074. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P20839. | ||||||||||||
| PRIDE | P20839. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000343214; ENSP00000342438; ENSG00000106348. ENST00000348127; ENSP00000265385; ENSG00000106348. ENST00000480861; ENSP00000420185; ENSG00000106348. ENST00000496200; ENSP00000420803; ENSG00000106348. | ||||||||||||
| GeneID | 3614. | ||||||||||||
| KEGG | hsa:3614. | ||||||||||||
| UCSC | uc003vmt.2. human. uc003vmv.2. human. uc011kol.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3614. | ||||||||||||
| GeneCards | GC07M128032. | ||||||||||||
| HGNC | HGNC:6052. IMPDH1. | ||||||||||||
| HPA | HPA001400. | ||||||||||||
| MIM | 146690. gene. 180105. phenotype. 613837. phenotype. | ||||||||||||
| neXtProt | NX_P20839. | ||||||||||||
| Orphanet | 65. Leber congenital amaurosis. 791. Retinitis pigmentosa. | ||||||||||||
| PharmGKB | PA29862. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0517. | ||||||||||||
| HOGENOM | HOG000165752. | ||||||||||||
| HOVERGEN | HBG052122. | ||||||||||||
| InParanoid | P20839. | ||||||||||||
| KO | K00088. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BioCyc | MetaCyc:HS02896-MONOMER. | ||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||
| SABIO-RK | P20839. | ||||||||||||
| UniPathway | UPA00601; UER00295. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P20839. | ||||||||||||
| Bgee | P20839. | ||||||||||||
| CleanEx | HS_IMPDH1. | ||||||||||||
| Genevestigator | P20839. | ||||||||||||
| GermOnline | ENSG00000106348. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.20.20.70. 1 hit. | ||||||||||||
| HAMAP | MF_01964. IMPDH. | ||||||||||||
| InterPro | IPR013785. Aldolase_TIM. IPR000644. Cysta_beta_synth_core. IPR005990. IMP_DH. IPR015875. IMP_DH/GMP_Rdtase_CS. IPR001093. IMP_DH_GMPRt. [Graphical view] | ||||||||||||
| PANTHER | PTHR11911:SF6. PTHR11911:SF6. 1 hit. | ||||||||||||
| Pfam | PF00571. CBS. 2 hits. PF00478. IMPDH. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF000130. IMPDH. 1 hit. | ||||||||||||
| SMART | SM00116. CBS. 2 hits. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR01302. IMP_dehydrog. 1 hit. | ||||||||||||
| PROSITE | PS51371. CBS. 2 hits. PS00487. IMP_DH_GMP_RED. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P20839. | ||||||||||||
| ChEMBL | CHEMBL1822. | ||||||||||||
| ChiTaRS | IMPDH1. human. | ||||||||||||
| DrugBank | DB00688. Mycophenolate mofetil. DB01024. Mycophenolic acid. DB00157. NADH. DB00811. Ribavirin. DB00352. Thioguanine. | ||||||||||||
| EvolutionaryTrace | P20839. | ||||||||||||
| GenomeRNAi | 3614. | ||||||||||||
| NextBio | 14135. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | IMDH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P20839 Secondary accession number(s): A4D0Z7 Q96NU2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
