Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P20815

- CP3A5_HUMAN

UniProt

P20815 - CP3A5_HUMAN

Protein

Cytochrome P450 3A5

Gene

CYP3A5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 152 (01 Oct 2014)
      Sequence version 1 (01 Feb 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

    Catalytic activityi

    RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

    Cofactori

    Heme group.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi441 – 4411Iron (heme axial ligand)

    GO - Molecular functioni

    1. aromatase activity Source: UniProtKB-EC
    2. heme binding Source: InterPro
    3. iron ion binding Source: InterPro
    4. monooxygenase activity Source: UniProtKB
    5. oxidoreductase activity Source: BHF-UCL
    6. oxygen binding Source: ProtInc

    GO - Biological processi

    1. alkaloid catabolic process Source: BHF-UCL
    2. drug catabolic process Source: BHF-UCL
    3. oxidative demethylation Source: BHF-UCL
    4. small molecule metabolic process Source: Reactome
    5. steroid metabolic process Source: ProtInc
    6. xenobiotic metabolic process Source: Reactome

    Keywords - Molecular functioni

    Monooxygenase, Oxidoreductase

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_13543. Xenobiotics.
    SABIO-RKP20815.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome P450 3A5 (EC:1.14.14.1)
    Alternative name(s):
    CYPIIIA5
    Cytochrome P450 HLp2
    Cytochrome P450-PCN3
    Gene namesi
    Name:CYP3A5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:2638. CYP3A5.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome
    2. intracellular membrane-bounded organelle Source: ProtInc

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti240945. Resistance to tacrolimus in transplantation.
    241043. Tacrolimus dose selection in transplantation.
    PharmGKBiPA131.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 502502Cytochrome P450 3A5PRO_0000051787Add
    BLAST

    Proteomic databases

    PaxDbiP20815.
    PRIDEiP20815.

    PTM databases

    PhosphoSiteiP20815.

    Expressioni

    Inductioni

    P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

    Gene expression databases

    ArrayExpressiP20815.
    BgeeiP20815.
    CleanExiHS_CYP3A5.
    GenevestigatoriP20815.

    Interactioni

    Protein-protein interaction databases

    BioGridi107949. 3 interactions.
    IntActiP20815. 4 interactions.
    STRINGi9606.ENSP00000222982.

    Structurei

    3D structure databases

    ProteinModelPortaliP20815.
    SMRiP20815. Positions 30-495.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytochrome P450 family.Curated

    Phylogenomic databases

    eggNOGiCOG2124.
    HOGENOMiHOG000082412.
    HOVERGENiHBG108567.
    InParanoidiP20815.
    KOiK17690.
    OMAiPKDTINF.
    OrthoDBiEOG744TBS.
    PhylomeDBiP20815.
    TreeFamiTF105087.

    Family and domain databases

    Gene3Di1.10.630.10. 1 hit.
    InterProiIPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR008072. Cyt_P450_E_CYP3A.
    IPR002402. Cyt_P450_E_grp-II.
    [Graphical view]
    PfamiPF00067. p450. 1 hit.
    [Graphical view]
    PRINTSiPR00464. EP450II.
    PR01689. EP450IICYP3A.
    PR00385. P450.
    SUPFAMiSSF48264. SSF48264. 1 hit.
    PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P20815-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDLIPNLAVE TWLLLAVSLV LLYLYGTRTH GLFKRLGIPG PTPLPLLGNV    50
    LSYRQGLWKF DTECYKKYGK MWGTYEGQLP VLAITDPDVI RTVLVKECYS 100
    VFTNRRSLGP VGFMKSAISL AEDEEWKRIR SLLSPTFTSG KLKEMFPIIA 150
    QYGDVLVRNL RREAEKGKPV TLKDIFGAYS MDVITGTSFG VNIDSLNNPQ 200
    DPFVESTKKF LKFGFLDPLF LSIILFPFLT PVFEALNVSL FPKDTINFLS 250
    KSVNRMKKSR LNDKQKHRLD FLQLMIDSQN SKETESHKAL SDLELAAQSI 300
    IFIFAGYETT SSVLSFTLYE LATHPDVQQK LQKEIDAVLP NKAPPTYDAV 350
    VQMEYLDMVV NETLRLFPVA IRLERTCKKD VEINGVFIPK GSMVVIPTYA 400
    LHHDPKYWTE PEEFRPERFS KKKDSIDPYI YTPFGTGPRN CIGMRFALMN 450
    MKLALIRVLQ NFSFKPCKET QIPLKLDTQG LLQPEKPIVL KVDSRDGTLS 500
    GE 502
    Length:502
    Mass (Da):57,109
    Last modified:February 1, 1991 - v1
    Checksum:iD5A2302E2633E717
    GO
    Isoform 2 (identifier: P20815-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         107-140: SLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG → ICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL
         141-502: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:140
    Mass (Da):15,846
    Checksum:iF40CE9C9DAE2CAC3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti305 – 3051A → P no nucleotide entry (PubMed:2802615)Curated
    Sequence conflicti318 – 3181L → F no nucleotide entry (PubMed:2802615)Curated
    Sequence conflicti324 – 3241H → D no nucleotide entry (PubMed:2802615)Curated
    Sequence conflicti377 – 3771C → G no nucleotide entry (PubMed:2802615)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti28 – 281R → C in allele CYP3A5*8. 1 Publication
    Corresponds to variant rs55817950 [ dbSNP | Ensembl ].
    VAR_024731
    Natural varianti30 – 301H → Y.1 Publication
    Corresponds to variant rs28383468 [ dbSNP | Ensembl ].
    VAR_024728
    Natural varianti200 – 2001Q → R in allele CYP3A5*4. 1 Publication
    Corresponds to variant rs56411402 [ dbSNP | Ensembl ].
    VAR_024732
    Natural varianti277 – 2771D → E.1 Publication
    Corresponds to variant rs28383477 [ dbSNP | Ensembl ].
    VAR_024729
    Natural varianti337 – 3371A → T in allele CYP3A5*9. 2 Publications
    Corresponds to variant rs28383479 [ dbSNP | Ensembl ].
    VAR_024730
    Natural varianti371 – 3711I → V.
    Corresponds to variant rs28365092 [ dbSNP | Ensembl ].
    VAR_029161
    Natural varianti398 – 3981T → N in allele CYP3A5*2. 2 Publications
    Corresponds to variant rs28365083 [ dbSNP | Ensembl ].
    VAR_008365
    Natural varianti446 – 4461F → S.1 Publication
    Corresponds to variant rs41279854 [ dbSNP | Ensembl ].
    VAR_024733
    Natural varianti488 – 4881I → T.
    Corresponds to variant rs28365085 [ dbSNP | Ensembl ].
    VAR_029162

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei107 – 14034SLGPV…TFTSG → ICATTSTIKMQTHSVTMWLP PAVLQSQHGVCLFL in isoform 2. 1 PublicationVSP_042734Add
    BLAST
    Alternative sequencei141 – 502362Missing in isoform 2. 1 PublicationVSP_042735Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J04813 mRNA. Translation: AAA02993.1.
    AK299002 mRNA. Translation: BAH12923.1.
    AC005020 Genomic DNA. Translation: AAS02016.1.
    CH236956 Genomic DNA. Translation: EAL23868.1.
    CH471091 Genomic DNA. Translation: EAW76638.1.
    CH471091 Genomic DNA. Translation: EAW76642.1.
    BC033862 mRNA. Translation: AAH33862.1.
    AF280107 Genomic DNA. Translation: AAG32288.1.
    L35912 Genomic DNA. Translation: AAB00083.1.
    S74699 Genomic DNA. Translation: AAD14157.1.
    S74700 Genomic DNA. Translation: AAD14158.1.
    CCDSiCCDS55134.1. [P20815-2]
    CCDS5672.1. [P20815-1]
    PIRiA34101.
    A60558.
    RefSeqiNP_000768.1. NM_000777.4. [P20815-1]
    NP_001177413.1. NM_001190484.2. [P20815-2]
    UniGeneiHs.571258.

    Genome annotation databases

    EnsembliENST00000222982; ENSP00000222982; ENSG00000106258. [P20815-1]
    ENST00000439761; ENSP00000401269; ENSG00000106258. [P20815-2]
    GeneIDi1577.
    KEGGihsa:1577.
    UCSCiuc003urq.3. human. [P20815-1]
    uc003urt.3. human. [P20815-2]

    Polymorphism databases

    DMDMi117157.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Cytochrome P450 Allele Nomenclature Committee

    CYP3A5 alleles

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    J04813 mRNA. Translation: AAA02993.1 .
    AK299002 mRNA. Translation: BAH12923.1 .
    AC005020 Genomic DNA. Translation: AAS02016.1 .
    CH236956 Genomic DNA. Translation: EAL23868.1 .
    CH471091 Genomic DNA. Translation: EAW76638.1 .
    CH471091 Genomic DNA. Translation: EAW76642.1 .
    BC033862 mRNA. Translation: AAH33862.1 .
    AF280107 Genomic DNA. Translation: AAG32288.1 .
    L35912 Genomic DNA. Translation: AAB00083.1 .
    S74699 Genomic DNA. Translation: AAD14157.1 .
    S74700 Genomic DNA. Translation: AAD14158.1 .
    CCDSi CCDS55134.1. [P20815-2 ]
    CCDS5672.1. [P20815-1 ]
    PIRi A34101.
    A60558.
    RefSeqi NP_000768.1. NM_000777.4. [P20815-1 ]
    NP_001177413.1. NM_001190484.2. [P20815-2 ]
    UniGenei Hs.571258.

    3D structure databases

    ProteinModelPortali P20815.
    SMRi P20815. Positions 30-495.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107949. 3 interactions.
    IntActi P20815. 4 interactions.
    STRINGi 9606.ENSP00000222982.

    Chemistry

    BindingDBi P20815.
    ChEMBLi CHEMBL2111472.
    DrugBanki DB00802. Alfentanil.
    DB00758. Clopidogrel.
    DB00091. Cyclosporine.
    DB00694. Daunorubicin.
    DB00224. Indinavir.
    DB00762. Irinotecan.
    DB01026. Ketoconazole.
    DB01259. Lapatinib.
    DB00532. Mephenytoin.
    DB00683. Midazolam.
    DB00834. Mifepristone.
    DB00252. Phenytoin.
    DB00468. Quinine.
    DB01232. Saquinavir.
    DB00864. Tacrolimus.
    DB01361. Troleandomycin.
    DB00661. Verapamil.
    DB00541. Vincristine.

    PTM databases

    PhosphoSitei P20815.

    Polymorphism databases

    DMDMi 117157.

    Proteomic databases

    PaxDbi P20815.
    PRIDEi P20815.

    Protocols and materials databases

    DNASUi 1577.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000222982 ; ENSP00000222982 ; ENSG00000106258 . [P20815-1 ]
    ENST00000439761 ; ENSP00000401269 ; ENSG00000106258 . [P20815-2 ]
    GeneIDi 1577.
    KEGGi hsa:1577.
    UCSCi uc003urq.3. human. [P20815-1 ]
    uc003urt.3. human. [P20815-2 ]

    Organism-specific databases

    CTDi 1577.
    GeneCardsi GC07M099246.
    HGNCi HGNC:2638. CYP3A5.
    MIMi 605325. gene.
    neXtProti NX_P20815.
    Orphaneti 240945. Resistance to tacrolimus in transplantation.
    241043. Tacrolimus dose selection in transplantation.
    PharmGKBi PA131.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2124.
    HOGENOMi HOG000082412.
    HOVERGENi HBG108567.
    InParanoidi P20815.
    KOi K17690.
    OMAi PKDTINF.
    OrthoDBi EOG744TBS.
    PhylomeDBi P20815.
    TreeFami TF105087.

    Enzyme and pathway databases

    Reactomei REACT_13543. Xenobiotics.
    SABIO-RK P20815.

    Miscellaneous databases

    GeneWikii CYP3A5.
    GenomeRNAii 1577.
    NextBioi 6479.
    PROi P20815.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P20815.
    Bgeei P20815.
    CleanExi HS_CYP3A5.
    Genevestigatori P20815.

    Family and domain databases

    Gene3Di 1.10.630.10. 1 hit.
    InterProi IPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR008072. Cyt_P450_E_CYP3A.
    IPR002402. Cyt_P450_E_grp-II.
    [Graphical view ]
    Pfami PF00067. p450. 1 hit.
    [Graphical view ]
    PRINTSi PR00464. EP450II.
    PR01689. EP450IICYP3A.
    PR00385. P450.
    SUPFAMi SSF48264. SSF48264. 1 hit.
    PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
      Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
      J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Characterization of a cDNA encoding a new member of the glucocorticoid-responsive cytochromes P450 in human liver."
      Schuetz J.D., Molowa D.T., Guzelian P.S.
      Arch. Biochem. Biophys. 274:355-365(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
      Tissue: Liver.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon.
    8. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-106.
    9. "Identification of a novel dexamethasone responsive enhancer in the human CYP3A5 gene and its activation in human and rat liver cells."
      Schuetz J.D., Schuetz E.G., Thottassery J.V., Guzelian P.S., Strom S., Sun D.
      Mol. Pharmacol. 49:63-72(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-24.
    10. "Sequence of the 5'-flanking region of CYP3A5: comparative analysis with CYP3A4 and CYP3A7."
      Jounaidi Y., Guzelian P.S., Maurel P., Vilarem M.J.
      Biochem. Biophys. Res. Commun. 205:1741-1747(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-24.
    11. "Intergenic mRNA molecules resulting from trans-splicing."
      Finta C., Zaphiropoulos P.G.
      J. Biol. Chem. 277:5882-5890(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TRANS-SPLICING.
    12. "Detection of CYP3A5 allelic variant: a candidate for the polymorphic expression of the protein?"
      Jounaidi Y., Hyrailles V., Gervot L., Maurel P.
      Biochem. Biophys. Res. Commun. 221:466-470(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CYP3A5*2 ASN-398.
    13. "Genetic polymorphism of cytochrome P450 3A5 in Chinese."
      Chou F.C., Tzeng S.J., Huang J.D.
      Drug Metab. Dispos. 29:1205-1209(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CYP3A5*4 ARG-200.
    14. "Genetic findings and functional studies of human CYP3A5 single nucleotide polymorphisms in different ethnic groups."
      Lee S.J., Usmani K.A., Chanas B., Ghanayem B., Xi T., Hodgson E., Mohrenweiser H.W., Goldstein J.A.
      Pharmacogenetics 13:461-472(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CYS-28; THR-337 AND SER-446.
    15. "Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population."
      Solus J.F., Arietta B.J., Harris J.R., Sexton D.P., Steward J.Q., McMunn C., Ihrie P., Mehall J.M., Edwards T.L., Dawson E.P.
      Pharmacogenomics 5:895-931(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS TYR-30; GLU-277; THR-337 AND ASN-398.

    Entry informationi

    Entry nameiCP3A5_HUMAN
    AccessioniPrimary (citable) accession number: P20815
    Secondary accession number(s): A4D289
    , B7Z5I7, Q53WY8, Q75MV0, Q9HB56
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1991
    Last sequence update: February 1, 1991
    Last modified: October 1, 2014
    This is version 152 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Chimeric transcripts, characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A5 exons, have been detected. All are possibly produced by trans-splicing. The chimeric transcripts exist in 2 different combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13 and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All chimeric transcripts are expressed at very low levels in the liver (PubMed:11726664).1 Publication

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3