Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 3A5

Gene

CYP3A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Catalytic activityi

RH + [reduced NADPH--hemoprotein reductase] + O2 = ROH + [oxidized NADPH--hemoprotein reductase] + H2O.

Cofactori

hemeBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi441Iron (heme axial ligand)1

GO - Molecular functioni

  • aromatase activity Source: UniProtKB-EC
  • estrogen 16-alpha-hydroxylase activity Source: BHF-UCL
  • heme binding Source: InterPro
  • iron ion binding Source: InterPro
  • monooxygenase activity Source: UniProtKB
  • oxidoreductase activity Source: BHF-UCL
  • oxygen binding Source: Reactome

GO - Biological processi

  • alkaloid catabolic process Source: BHF-UCL
  • drug catabolic process Source: BHF-UCL
  • lipid hydroxylation Source: BHF-UCL
  • oxidative demethylation Source: BHF-UCL
  • steroid metabolic process Source: BHF-UCL
  • xenobiotic metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:HS02875-MONOMER.
BRENDAi1.14.14.1. 2681.
ReactomeiR-HSA-211981. Xenobiotics.
R-HSA-5423646. Aflatoxin activation and detoxification.
SABIO-RKP20815.

Chemistry databases

SwissLipidsiSLP:000001325.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 3A5 (EC:1.14.14.1)
Alternative name(s):
CYPIIIA5
Cytochrome P450 HLp2
Cytochrome P450-PCN3
Gene namesi
Name:CYP3A5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:2638. CYP3A5.

Subcellular locationi

GO - Cellular componenti

  • endoplasmic reticulum membrane Source: Reactome
  • intracellular membrane-bounded organelle Source: ProtInc
  • organelle membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi1577.
MalaCardsiCYP3A5.
OpenTargetsiENSG00000106258.
Orphaneti241043. Tacrolimus dose selection.
PharmGKBiPA131.

Chemistry databases

ChEMBLiCHEMBL3019.
DrugBankiDB05773. ado-trastuzumab emtansine.
DB00802. Alfentanil.
DB00404. Alprazolam.
DB06403. Ambrisentan.
DB01118. Amiodarone.
DB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB06605. Apixaban.
DB00673. Aprepitant.
DB00278. Argatroban.
DB01238. Aripiprazole.
DB06413. Armodafinil.
DB06697. Artemether.
DB00637. Astemizole.
DB01076. Atorvastatin.
DB06626. Axitinib.
DB00972. Azelastine.
DB00394. Beclomethasone.
DB08873. Boceprevir.
DB08870. Brentuximab vedotin.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB06772. Cabazitaxel.
DB00201. Caffeine.
DB00564. Carbamazepine.
DB00446. Chloramphenicol.
DB00608. Chloroquine.
DB01114. Chlorphenamine.
DB01166. Cilostazol.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00604. Cisapride.
DB01211. Clarithromycin.
DB00575. Clonidine.
DB00758. Clopidogrel.
DB05239. Cobimetinib.
DB00907. Cocaine.
DB00318. Codeine.
DB08865. Crizotinib.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB09102. Daclatasvir.
DB00250. Dapsone.
DB01254. Dasatinib.
DB00694. Daunorubicin.
DB00705. Delavirdine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00343. Diltiazem.
DB00822. Disulfiram.
DB01248. Docetaxel.
DB08930. Dolutegravir.
DB01184. Domperidone.
DB01126. Dutasteride.
DB08899. Enzalutamide.
DB00700. Eplerenone.
DB00530. Erlotinib.
DB00199. Erythromycin.
DB00783. Estradiol.
DB00655. Estrone.
DB00593. Ethosuximide.
DB00773. Etoposide.
DB01023. Felodipine.
DB00813. Fentanyl.
DB01216. Finasteride.
DB00196. Fluconazole.
DB00472. Fluoxetine.
DB00499. Flutamide.
DB00588. Fluticasone Propionate.
DB01095. Fluvastatin.
DB00176. Fluvoxamine.
DB00317. Gefitinib.
DB06730. Gestodene.
DB00889. Granisetron.
DB01218. Halofantrine.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB06789. Hydroxyprogesterone caproate.
DB09053. Ibrutinib.
DB01181. Ifosfamide.
DB04946. Iloperidone.
DB00619. Imatinib.
DB00224. Indinavir.
DB00762. Irinotecan.
DB01167. Itraconazole.
DB01026. Ketoconazole.
DB01259. Lapatinib.
DB00528. Lercanidipine.
DB01227. Levomethadyl Acetate.
DB00281. Lidocaine.
DB00678. Losartan.
DB00227. Lovastatin.
DB00333. Methadone.
DB00683. Midazolam.
DB00834. Mifepristone.
DB00745. Modafinil.
DB00688. Mycophenolate mofetil.
DB00731. Nateglinide.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB00238. Nevirapine.
DB00622. Nicardipine.
DB01115. Nifedipine.
DB00393. Nimodipine.
DB00401. Nisoldipine.
DB01054. Nitrendipine.
DB00717. Norethisterone.
DB01059. Norfloxacin.
DB00540. Nortriptyline.
DB00904. Ondansetron.
DB00842. Oxazepam.
DB00776. Oxcarbazepine.
DB01062. Oxybutynin.
DB00497. Oxycodone.
DB01229. Paclitaxel.
DB01267. Paliperidone.
DB00738. Pentamidine.
DB08883. Perampanel.
DB00780. Phenelzine.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB08901. Ponatinib.
DB00175. Pravastatin.
DB01058. Praziquantel.
DB00396. Progesterone.
DB00571. Propranolol.
DB01224. Quetiapine.
DB01103. Quinacrine.
DB00468. Quinine.
DB00863. Ranitidine.
DB00206. Reserpine.
DB01045. Rifampicin.
DB01201. Rifapentine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB06228. Rivaroxaban.
DB06176. Romidepsin.
DB01098. Rosuvastatin.
DB00938. Salmeterol.
DB01232. Saquinavir.
DB06335. Saxagliptin.
DB00203. Sildenafil.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB00398. Sorafenib.
DB00795. Sulfasalazine.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB00976. Telithromycin.
DB06287. Temsirolimus.
DB00444. Teniposide.
DB00624. Testosterone.
DB01041. Thalidomide.
DB00656. Trazodone.
DB00755. Tretinoin.
DB00897. Triazolam.
DB01361. Troleandomycin.
DB06267. Udenafil.
DB00313. Valproic Acid.
DB00862. Vardenafil.
DB00661. Verapamil.
DB00541. Vincristine.
DB00582. Voriconazole.
DB09068. Vortioxetine.
DB00943. Zalcitabine.
DB00962. Zaleplon.
DB00246. Ziprasidone.
DB00425. Zolpidem.
GuidetoPHARMACOLOGYi1338.

Polymorphism and mutation databases

BioMutaiCYP3A5.
DMDMi117157.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000517871 – 502Cytochrome P450 3A5Add BLAST502

Proteomic databases

PaxDbiP20815.
PeptideAtlasiP20815.
PRIDEiP20815.

PTM databases

iPTMnetiP20815.
PhosphoSitePlusiP20815.

Expressioni

Inductioni

P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

Gene expression databases

BgeeiENSG00000106258.
CleanExiHS_CYP3A5.
ExpressionAtlasiP20815. baseline and differential.
GenevisibleiP20815. HS.

Interactioni

Protein-protein interaction databases

BioGridi107949. 7 interactors.
IntActiP20815. 4 interactors.
STRINGi9606.ENSP00000222982.

Chemistry databases

BindingDBiP20815.

Structurei

3D structure databases

ProteinModelPortaliP20815.
SMRiP20815.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiKOG0158. Eukaryota.
COG2124. LUCA.
GeneTreeiENSGT00760000118816.
HOGENOMiHOG000082412.
HOVERGENiHBG108567.
InParanoidiP20815.
KOiK17690.
OMAiPKDTINF.
OrthoDBiEOG091G0JNC.
PhylomeDBiP20815.
TreeFamiTF105087.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR008072. Cyt_P450_E_CYP3A.
IPR002402. Cyt_P450_E_grp-II.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00464. EP450II.
PR01689. EP450IICYP3A.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P20815-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLIPNLAVE TWLLLAVSLV LLYLYGTRTH GLFKRLGIPG PTPLPLLGNV
60 70 80 90 100
LSYRQGLWKF DTECYKKYGK MWGTYEGQLP VLAITDPDVI RTVLVKECYS
110 120 130 140 150
VFTNRRSLGP VGFMKSAISL AEDEEWKRIR SLLSPTFTSG KLKEMFPIIA
160 170 180 190 200
QYGDVLVRNL RREAEKGKPV TLKDIFGAYS MDVITGTSFG VNIDSLNNPQ
210 220 230 240 250
DPFVESTKKF LKFGFLDPLF LSIILFPFLT PVFEALNVSL FPKDTINFLS
260 270 280 290 300
KSVNRMKKSR LNDKQKHRLD FLQLMIDSQN SKETESHKAL SDLELAAQSI
310 320 330 340 350
IFIFAGYETT SSVLSFTLYE LATHPDVQQK LQKEIDAVLP NKAPPTYDAV
360 370 380 390 400
VQMEYLDMVV NETLRLFPVA IRLERTCKKD VEINGVFIPK GSMVVIPTYA
410 420 430 440 450
LHHDPKYWTE PEEFRPERFS KKKDSIDPYI YTPFGTGPRN CIGMRFALMN
460 470 480 490 500
MKLALIRVLQ NFSFKPCKET QIPLKLDTQG LLQPEKPIVL KVDSRDGTLS

GE
Length:502
Mass (Da):57,109
Last modified:February 1, 1991 - v1
Checksum:iD5A2302E2633E717
GO
Isoform 2 (identifier: P20815-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-140: SLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG → ICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL
     141-502: Missing.

Note: No experimental confirmation available.
Show »
Length:140
Mass (Da):15,846
Checksum:iF40CE9C9DAE2CAC3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti305A → P no nucleotide entry (PubMed:2802615).Curated1
Sequence conflicti318L → F no nucleotide entry (PubMed:2802615).Curated1
Sequence conflicti324H → D no nucleotide entry (PubMed:2802615).Curated1
Sequence conflicti377C → G no nucleotide entry (PubMed:2802615).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02473128R → C in allele CYP3A5*8. 1 PublicationCorresponds to variant rs55817950dbSNPEnsembl.1
Natural variantiVAR_02472830H → Y.1 PublicationCorresponds to variant rs28383468dbSNPEnsembl.1
Natural variantiVAR_024732200Q → R in allele CYP3A5*4. 1 PublicationCorresponds to variant rs56411402dbSNPEnsembl.1
Natural variantiVAR_024729277D → E.1 PublicationCorresponds to variant rs28383477dbSNPEnsembl.1
Natural variantiVAR_024730337A → T in allele CYP3A5*9. 2 PublicationsCorresponds to variant rs28383479dbSNPEnsembl.1
Natural variantiVAR_029161371I → V.Corresponds to variant rs28365092dbSNPEnsembl.1
Natural variantiVAR_008365398T → N in allele CYP3A5*2. 2 PublicationsCorresponds to variant rs28365083dbSNPEnsembl.1
Natural variantiVAR_024733446F → S.1 PublicationCorresponds to variant rs41279854dbSNPEnsembl.1
Natural variantiVAR_029162488I → T.Corresponds to variant rs28365085dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042734107 – 140SLGPV…TFTSG → ICATTSTIKMQTHSVTMWLP PAVLQSQHGVCLFL in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_042735141 – 502Missing in isoform 2. 1 PublicationAdd BLAST362

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04813 mRNA. Translation: AAA02993.1.
AK299002 mRNA. Translation: BAH12923.1.
AC005020 Genomic DNA. Translation: AAS02016.1.
CH236956 Genomic DNA. Translation: EAL23868.1.
CH471091 Genomic DNA. Translation: EAW76638.1.
CH471091 Genomic DNA. Translation: EAW76642.1.
BC033862 mRNA. Translation: AAH33862.1.
AF280107 Genomic DNA. Translation: AAG32288.1.
L35912 Genomic DNA. Translation: AAB00083.1.
S74699 Genomic DNA. Translation: AAD14157.1.
S74700 Genomic DNA. Translation: AAD14158.1.
CCDSiCCDS55134.1. [P20815-2]
CCDS5672.1. [P20815-1]
PIRiA34101.
A60558.
RefSeqiNP_000768.1. NM_000777.4. [P20815-1]
NP_001177413.1. NM_001190484.2. [P20815-2]
UniGeneiHs.571258.

Genome annotation databases

EnsembliENST00000222982; ENSP00000222982; ENSG00000106258. [P20815-1]
ENST00000439761; ENSP00000401269; ENSG00000106258. [P20815-2]
GeneIDi1577.
KEGGihsa:1577.
UCSCiuc003urq.4. human. [P20815-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP3A5 alleles

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04813 mRNA. Translation: AAA02993.1.
AK299002 mRNA. Translation: BAH12923.1.
AC005020 Genomic DNA. Translation: AAS02016.1.
CH236956 Genomic DNA. Translation: EAL23868.1.
CH471091 Genomic DNA. Translation: EAW76638.1.
CH471091 Genomic DNA. Translation: EAW76642.1.
BC033862 mRNA. Translation: AAH33862.1.
AF280107 Genomic DNA. Translation: AAG32288.1.
L35912 Genomic DNA. Translation: AAB00083.1.
S74699 Genomic DNA. Translation: AAD14157.1.
S74700 Genomic DNA. Translation: AAD14158.1.
CCDSiCCDS55134.1. [P20815-2]
CCDS5672.1. [P20815-1]
PIRiA34101.
A60558.
RefSeqiNP_000768.1. NM_000777.4. [P20815-1]
NP_001177413.1. NM_001190484.2. [P20815-2]
UniGeneiHs.571258.

3D structure databases

ProteinModelPortaliP20815.
SMRiP20815.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107949. 7 interactors.
IntActiP20815. 4 interactors.
STRINGi9606.ENSP00000222982.

Chemistry databases

BindingDBiP20815.
ChEMBLiCHEMBL3019.
DrugBankiDB05773. ado-trastuzumab emtansine.
DB00802. Alfentanil.
DB00404. Alprazolam.
DB06403. Ambrisentan.
DB01118. Amiodarone.
DB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB06605. Apixaban.
DB00673. Aprepitant.
DB00278. Argatroban.
DB01238. Aripiprazole.
DB06413. Armodafinil.
DB06697. Artemether.
DB00637. Astemizole.
DB01076. Atorvastatin.
DB06626. Axitinib.
DB00972. Azelastine.
DB00394. Beclomethasone.
DB08873. Boceprevir.
DB08870. Brentuximab vedotin.
DB00921. Buprenorphine.
DB00490. Buspirone.
DB06772. Cabazitaxel.
DB00201. Caffeine.
DB00564. Carbamazepine.
DB00446. Chloramphenicol.
DB00608. Chloroquine.
DB01114. Chlorphenamine.
DB01166. Cilostazol.
DB00501. Cimetidine.
DB00537. Ciprofloxacin.
DB00604. Cisapride.
DB01211. Clarithromycin.
DB00575. Clonidine.
DB00758. Clopidogrel.
DB05239. Cobimetinib.
DB00907. Cocaine.
DB00318. Codeine.
DB08865. Crizotinib.
DB00531. Cyclophosphamide.
DB00091. Cyclosporine.
DB09102. Daclatasvir.
DB00250. Dapsone.
DB01254. Dasatinib.
DB00694. Daunorubicin.
DB00705. Delavirdine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00343. Diltiazem.
DB00822. Disulfiram.
DB01248. Docetaxel.
DB08930. Dolutegravir.
DB01184. Domperidone.
DB01126. Dutasteride.
DB08899. Enzalutamide.
DB00700. Eplerenone.
DB00530. Erlotinib.
DB00199. Erythromycin.
DB00783. Estradiol.
DB00655. Estrone.
DB00593. Ethosuximide.
DB00773. Etoposide.
DB01023. Felodipine.
DB00813. Fentanyl.
DB01216. Finasteride.
DB00196. Fluconazole.
DB00472. Fluoxetine.
DB00499. Flutamide.
DB00588. Fluticasone Propionate.
DB01095. Fluvastatin.
DB00176. Fluvoxamine.
DB00317. Gefitinib.
DB06730. Gestodene.
DB00889. Granisetron.
DB01218. Halofantrine.
DB00502. Haloperidol.
DB00741. Hydrocortisone.
DB06789. Hydroxyprogesterone caproate.
DB09053. Ibrutinib.
DB01181. Ifosfamide.
DB04946. Iloperidone.
DB00619. Imatinib.
DB00224. Indinavir.
DB00762. Irinotecan.
DB01167. Itraconazole.
DB01026. Ketoconazole.
DB01259. Lapatinib.
DB00528. Lercanidipine.
DB01227. Levomethadyl Acetate.
DB00281. Lidocaine.
DB00678. Losartan.
DB00227. Lovastatin.
DB00333. Methadone.
DB00683. Midazolam.
DB00834. Mifepristone.
DB00745. Modafinil.
DB00688. Mycophenolate mofetil.
DB00731. Nateglinide.
DB01149. Nefazodone.
DB00220. Nelfinavir.
DB00238. Nevirapine.
DB00622. Nicardipine.
DB01115. Nifedipine.
DB00393. Nimodipine.
DB00401. Nisoldipine.
DB01054. Nitrendipine.
DB00717. Norethisterone.
DB01059. Norfloxacin.
DB00540. Nortriptyline.
DB00904. Ondansetron.
DB00842. Oxazepam.
DB00776. Oxcarbazepine.
DB01062. Oxybutynin.
DB00497. Oxycodone.
DB01229. Paclitaxel.
DB01267. Paliperidone.
DB00738. Pentamidine.
DB08883. Perampanel.
DB00780. Phenelzine.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB01100. Pimozide.
DB08901. Ponatinib.
DB00175. Pravastatin.
DB01058. Praziquantel.
DB00396. Progesterone.
DB00571. Propranolol.
DB01224. Quetiapine.
DB01103. Quinacrine.
DB00468. Quinine.
DB00863. Ranitidine.
DB00206. Reserpine.
DB01045. Rifampicin.
DB01201. Rifapentine.
DB00734. Risperidone.
DB00503. Ritonavir.
DB06228. Rivaroxaban.
DB06176. Romidepsin.
DB01098. Rosuvastatin.
DB00938. Salmeterol.
DB01232. Saquinavir.
DB06335. Saxagliptin.
DB00203. Sildenafil.
DB00641. Simvastatin.
DB00877. Sirolimus.
DB00398. Sorafenib.
DB00795. Sulfasalazine.
DB01268. Sunitinib.
DB00864. Tacrolimus.
DB00675. Tamoxifen.
DB00976. Telithromycin.
DB06287. Temsirolimus.
DB00444. Teniposide.
DB00624. Testosterone.
DB01041. Thalidomide.
DB00656. Trazodone.
DB00755. Tretinoin.
DB00897. Triazolam.
DB01361. Troleandomycin.
DB06267. Udenafil.
DB00313. Valproic Acid.
DB00862. Vardenafil.
DB00661. Verapamil.
DB00541. Vincristine.
DB00582. Voriconazole.
DB09068. Vortioxetine.
DB00943. Zalcitabine.
DB00962. Zaleplon.
DB00246. Ziprasidone.
DB00425. Zolpidem.
GuidetoPHARMACOLOGYi1338.
SwissLipidsiSLP:000001325.

PTM databases

iPTMnetiP20815.
PhosphoSitePlusiP20815.

Polymorphism and mutation databases

BioMutaiCYP3A5.
DMDMi117157.

Proteomic databases

PaxDbiP20815.
PeptideAtlasiP20815.
PRIDEiP20815.

Protocols and materials databases

DNASUi1577.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222982; ENSP00000222982; ENSG00000106258. [P20815-1]
ENST00000439761; ENSP00000401269; ENSG00000106258. [P20815-2]
GeneIDi1577.
KEGGihsa:1577.
UCSCiuc003urq.4. human. [P20815-1]

Organism-specific databases

CTDi1577.
DisGeNETi1577.
GeneCardsiCYP3A5.
HGNCiHGNC:2638. CYP3A5.
MalaCardsiCYP3A5.
MIMi605325. gene.
neXtProtiNX_P20815.
OpenTargetsiENSG00000106258.
Orphaneti241043. Tacrolimus dose selection.
PharmGKBiPA131.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0158. Eukaryota.
COG2124. LUCA.
GeneTreeiENSGT00760000118816.
HOGENOMiHOG000082412.
HOVERGENiHBG108567.
InParanoidiP20815.
KOiK17690.
OMAiPKDTINF.
OrthoDBiEOG091G0JNC.
PhylomeDBiP20815.
TreeFamiTF105087.

Enzyme and pathway databases

BioCyciZFISH:HS02875-MONOMER.
BRENDAi1.14.14.1. 2681.
ReactomeiR-HSA-211981. Xenobiotics.
R-HSA-5423646. Aflatoxin activation and detoxification.
SABIO-RKP20815.

Miscellaneous databases

GeneWikiiCYP3A5.
GenomeRNAii1577.
PROiP20815.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106258.
CleanExiHS_CYP3A5.
ExpressionAtlasiP20815. baseline and differential.
GenevisibleiP20815. HS.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR008072. Cyt_P450_E_CYP3A.
IPR002402. Cyt_P450_E_grp-II.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00464. EP450II.
PR01689. EP450IICYP3A.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCP3A5_HUMAN
AccessioniPrimary (citable) accession number: P20815
Secondary accession number(s): A4D289
, B7Z5I7, Q53WY8, Q75MV0, Q9HB56
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 2, 2016
This is version 174 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Chimeric transcripts, characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A5 exons, have been detected. All are possibly produced by trans-splicing. The chimeric transcripts exist in 2 different combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13 and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All chimeric transcripts are expressed at very low levels in the liver (PubMed:11726664).1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.