Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P20815 (CP3A5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 150. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytochrome P450 3A5

EC=1.14.14.1
Alternative name(s):
CYPIIIA5
Cytochrome P450 HLp2
Cytochrome P450-PCN3
Gene names
Name:CYP3A5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length502 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Catalytic activity

RH + reduced flavoprotein + O2 = ROH + oxidized flavoprotein + H2O.

Cofactor

Heme group By similarity.

Subcellular location

Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Induction

P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.

Miscellaneous

Chimeric transcripts, characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A5 exons, have been detected. All are possibly produced by trans-splicing. The chimeric transcripts exist in 2 different combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13 and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All chimeric transcripts are expressed at very low levels in the liver (Ref.11).

Sequence similarities

Belongs to the cytochrome P450 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P20815-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P20815-2)

The sequence of this isoform differs from the canonical sequence as follows:
     107-140: SLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG → ICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL
     141-502: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 502502Cytochrome P450 3A5
PRO_0000051787

Sites

Metal binding4411Iron (heme axial ligand)

Natural variations

Alternative sequence107 – 14034SLGPV…TFTSG → ICATTSTIKMQTHSVTMWLP PAVLQSQHGVCLFL in isoform 2.
VSP_042734
Alternative sequence141 – 502362Missing in isoform 2.
VSP_042735
Natural variant281R → C in allele CYP3A5*8. Ref.14
Corresponds to variant rs55817950 [ dbSNP | Ensembl ].
VAR_024731
Natural variant301H → Y. Ref.15
Corresponds to variant rs28383468 [ dbSNP | Ensembl ].
VAR_024728
Natural variant2001Q → R in allele CYP3A5*4. Ref.13
Corresponds to variant rs56411402 [ dbSNP | Ensembl ].
VAR_024732
Natural variant2771D → E. Ref.15
Corresponds to variant rs28383477 [ dbSNP | Ensembl ].
VAR_024729
Natural variant3371A → T in allele CYP3A5*9. Ref.14 Ref.15
Corresponds to variant rs28383479 [ dbSNP | Ensembl ].
VAR_024730
Natural variant3711I → V.
Corresponds to variant rs28365092 [ dbSNP | Ensembl ].
VAR_029161
Natural variant3981T → N in allele CYP3A5*2. Ref.12 Ref.15
Corresponds to variant rs28365083 [ dbSNP | Ensembl ].
VAR_008365
Natural variant4461F → S. Ref.14
Corresponds to variant rs41279854 [ dbSNP | Ensembl ].
VAR_024733
Natural variant4881I → T.
Corresponds to variant rs28365085 [ dbSNP | Ensembl ].
VAR_029162

Experimental info

Sequence conflict3051A → P no nucleotide entry Ref.2
Sequence conflict3181L → F no nucleotide entry Ref.2
Sequence conflict3241H → D no nucleotide entry Ref.2
Sequence conflict3771C → G no nucleotide entry Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1991. Version 1.
Checksum: D5A2302E2633E717

FASTA50257,109
        10         20         30         40         50         60 
MDLIPNLAVE TWLLLAVSLV LLYLYGTRTH GLFKRLGIPG PTPLPLLGNV LSYRQGLWKF 

        70         80         90        100        110        120 
DTECYKKYGK MWGTYEGQLP VLAITDPDVI RTVLVKECYS VFTNRRSLGP VGFMKSAISL 

       130        140        150        160        170        180 
AEDEEWKRIR SLLSPTFTSG KLKEMFPIIA QYGDVLVRNL RREAEKGKPV TLKDIFGAYS 

       190        200        210        220        230        240 
MDVITGTSFG VNIDSLNNPQ DPFVESTKKF LKFGFLDPLF LSIILFPFLT PVFEALNVSL 

       250        260        270        280        290        300 
FPKDTINFLS KSVNRMKKSR LNDKQKHRLD FLQLMIDSQN SKETESHKAL SDLELAAQSI 

       310        320        330        340        350        360 
IFIFAGYETT SSVLSFTLYE LATHPDVQQK LQKEIDAVLP NKAPPTYDAV VQMEYLDMVV 

       370        380        390        400        410        420 
NETLRLFPVA IRLERTCKKD VEINGVFIPK GSMVVIPTYA LHHDPKYWTE PEEFRPERFS 

       430        440        450        460        470        480 
KKKDSIDPYI YTPFGTGPRN CIGMRFALMN MKLALIRVLQ NFSFKPCKET QIPLKLDTQG 

       490        500 
LLQPEKPIVL KVDSRDGTLS GE 

« Hide

Isoform 2 [UniParc].

Checksum: F40CE9C9DAE2CAC3
Show »

FASTA14015,846

References

« Hide 'large scale' references
[1]"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine."
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A., Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V., Gonzalez F.J.
J. Biol. Chem. 264:10388-10395(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Characterization of a cDNA encoding a new member of the glucocorticoid-responsive cytochromes P450 in human liver."
Schuetz J.D., Molowa D.T., Guzelian P.S.
Arch. Biochem. Biophys. 274:355-365(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
Tissue: Liver.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Colon.
[8]"Genomic organization of the human CYP3A locus: identification of a new, inducible CYP3A gene."
Gellner K., Eiselt R., Hustert E., Arnold H., Koch I., Haberl M., Deglmann C.J., Burk O., Buntefuss D., Escher S., Bishop C., Koebe H.-G., Brinkmann U., Klenk H.-P., Kleine K., Meyer U.A., Wojnowski L.
Pharmacogenetics 11:111-121(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-106.
[9]"Identification of a novel dexamethasone responsive enhancer in the human CYP3A5 gene and its activation in human and rat liver cells."
Schuetz J.D., Schuetz E.G., Thottassery J.V., Guzelian P.S., Strom S., Sun D.
Mol. Pharmacol. 49:63-72(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-24.
[10]"Sequence of the 5'-flanking region of CYP3A5: comparative analysis with CYP3A4 and CYP3A7."
Jounaidi Y., Guzelian P.S., Maurel P., Vilarem M.J.
Biochem. Biophys. Res. Commun. 205:1741-1747(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-24.
[11]"Intergenic mRNA molecules resulting from trans-splicing."
Finta C., Zaphiropoulos P.G.
J. Biol. Chem. 277:5882-5890(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TRANS-SPLICING.
[12]"Detection of CYP3A5 allelic variant: a candidate for the polymorphic expression of the protein?"
Jounaidi Y., Hyrailles V., Gervot L., Maurel P.
Biochem. Biophys. Res. Commun. 221:466-470(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT CYP3A5*2 ASN-398.
[13]"Genetic polymorphism of cytochrome P450 3A5 in Chinese."
Chou F.C., Tzeng S.J., Huang J.D.
Drug Metab. Dispos. 29:1205-1209(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT CYP3A5*4 ARG-200.
[14]"Genetic findings and functional studies of human CYP3A5 single nucleotide polymorphisms in different ethnic groups."
Lee S.J., Usmani K.A., Chanas B., Ghanayem B., Xi T., Hodgson E., Mohrenweiser H.W., Goldstein J.A.
Pharmacogenetics 13:461-472(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS CYS-28; THR-337 AND SER-446.
[15]"Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population."
Solus J.F., Arietta B.J., Harris J.R., Sexton D.P., Steward J.Q., McMunn C., Ihrie P., Mehall J.M., Edwards T.L., Dawson E.P.
Pharmacogenomics 5:895-931(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS TYR-30; GLU-277; THR-337 AND ASN-398.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
J04813 mRNA. Translation: AAA02993.1.
AK299002 mRNA. Translation: BAH12923.1.
AC005020 Genomic DNA. Translation: AAS02016.1.
CH236956 Genomic DNA. Translation: EAL23868.1.
CH471091 Genomic DNA. Translation: EAW76638.1.
CH471091 Genomic DNA. Translation: EAW76642.1.
BC033862 mRNA. Translation: AAH33862.1.
AF280107 Genomic DNA. Translation: AAG32288.1.
L35912 Genomic DNA. Translation: AAB00083.1.
S74699 Genomic DNA. Translation: AAD14157.1.
S74700 Genomic DNA. Translation: AAD14158.1.
CCDSCCDS55134.1. [P20815-2]
CCDS5672.1. [P20815-1]
PIRA34101.
A60558.
RefSeqNP_000768.1. NM_000777.4. [P20815-1]
NP_001177413.1. NM_001190484.2. [P20815-2]
UniGeneHs.571258.

3D structure databases

ProteinModelPortalP20815.
SMRP20815. Positions 30-495.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107949. 3 interactions.
IntActP20815. 4 interactions.
STRING9606.ENSP00000222982.

Chemistry

BindingDBP20815.
ChEMBLCHEMBL2111472.
DrugBankDB00802. Alfentanil.
DB00758. Clopidogrel.
DB00091. Cyclosporine.
DB00694. Daunorubicin.
DB00224. Indinavir.
DB00762. Irinotecan.
DB01026. Ketoconazole.
DB01259. Lapatinib.
DB00532. Mephenytoin.
DB00683. Midazolam.
DB00834. Mifepristone.
DB00252. Phenytoin.
DB00468. Quinine.
DB01232. Saquinavir.
DB00864. Tacrolimus.
DB01361. Troleandomycin.
DB00661. Verapamil.
DB00541. Vincristine.

PTM databases

PhosphoSiteP20815.

Polymorphism databases

DMDM117157.

Proteomic databases

PaxDbP20815.
PRIDEP20815.

Protocols and materials databases

DNASU1577.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000222982; ENSP00000222982; ENSG00000106258. [P20815-1]
ENST00000439761; ENSP00000401269; ENSG00000106258. [P20815-2]
GeneID1577.
KEGGhsa:1577.
UCSCuc003urq.3. human. [P20815-1]
uc003urt.3. human. [P20815-2]

Organism-specific databases

CTD1577.
GeneCardsGC07M099246.
HGNCHGNC:2638. CYP3A5.
MIM605325. gene.
neXtProtNX_P20815.
Orphanet240945. Resistance to tacrolimus in transplantation.
241043. Tacrolimus dose selection in transplantation.
PharmGKBPA131.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2124.
HOGENOMHOG000082412.
HOVERGENHBG108567.
InParanoidP20815.
KOK17690.
OMAPKDTINF.
OrthoDBEOG744TBS.
PhylomeDBP20815.
TreeFamTF105087.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
SABIO-RKP20815.

Gene expression databases

ArrayExpressP20815.
BgeeP20815.
CleanExHS_CYP3A5.
GenevestigatorP20815.

Family and domain databases

Gene3D1.10.630.10. 1 hit.
InterProIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR008072. Cyt_P450_E_CYP3A.
IPR002402. Cyt_P450_E_grp-II.
[Graphical view]
PfamPF00067. p450. 1 hit.
[Graphical view]
PRINTSPR00464. EP450II.
PR01689. EP450IICYP3A.
PR00385. P450.
SUPFAMSSF48264. SSF48264. 1 hit.
PROSITEPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCYP3A5.
GenomeRNAi1577.
NextBio6479.
PROP20815.
SOURCESearch...

Entry information

Entry nameCP3A5_HUMAN
AccessionPrimary (citable) accession number: P20815
Secondary accession number(s): A4D289 expand/collapse secondary AC list , B7Z5I7, Q53WY8, Q75MV0, Q9HB56
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: July 9, 2014
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM