SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P20813

- CP2B6_HUMAN

UniProt

P20813 - CP2B6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cytochrome P450 2B6
Gene
CYP2B6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,4-cineole 2-exo-monooxygenase.4 Publications

Catalytic activityi

1,4-cineole + NADPH + O2 = 2-exo-hydroxy-1,4-cineole + NADP+ + H2O.1 Publication

Cofactori

Heme group.3 Publications

Kineticsi

  1. KM=360 µM for 1,4-cineole1 Publication

Vmax=3.4 nmol/min/nmol enzyme toward 2-exo-hydroxy-1,4-cineole

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi436 – 4361Iron (heme axial ligand)

GO - Molecular functioni

  1. heme binding Source: UniProtKB
  2. iron ion binding Source: InterPro
  3. monooxygenase activity Source: BHF-UCL
  4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Source: InterPro

GO - Biological processi

  1. cellular ketone metabolic process Source: BHF-UCL
  2. drug metabolic process Source: BHF-UCL
  3. exogenous drug catabolic process Source: BHF-UCL
  4. oxidation-reduction process Source: BHF-UCL
  5. small molecule metabolic process Source: Reactome
  6. steroid metabolic process Source: BHF-UCL
  7. xenobiotic metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCyciMetaCyc:HS09587-MONOMER.
ReactomeiREACT_13543. Xenobiotics.
REACT_13797. CYP2E1 reactions.
REACT_13814. Fatty acids.
SABIO-RKP20813.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 2B6 (EC:1.14.13.-)
Alternative name(s):
1,4-cineole 2-exo-monooxygenase
CYPIIB6
Cytochrome P450 IIB1
Gene namesi
Name:CYP2B6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:2615. CYP2B6.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

MIMi614546. phenotype.
Orphaneti240869. Efavirenz toxicity.
240969. Susceptibility to adverse reaction due to efavirenz treatment.
PharmGKBiPA123.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 491491Cytochrome P450 2B6
PRO_0000051683Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei128 – 1281Phosphoserine; by PKA By similarity

Post-translational modificationi

Phosphorylation is accompanied by a decrease in enzyme activity By similarity.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP20813.
PRIDEiP20813.

PTM databases

PhosphoSiteiP20813.

Expressioni

Tissue specificityi

Expressed in liver, lung and heart right ventricle.1 Publication

Inductioni

By phenobarbital.

Gene expression databases

ArrayExpressiP20813.
BgeeiP20813.
CleanExiHS_CYP2B6.
GenevestigatoriP20813.

Organism-specific databases

HPAiCAB033866.
HPA048124.

Interactioni

Protein-protein interaction databases

BioGridi107933. 1 interaction.
STRINGi9606.ENSP00000324648.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni38 – 403
Helixi43 – 453
Helixi51 – 6212
Beta strandi64 – 707
Beta strandi73 – 786
Helixi81 – 888
Turni89 – 935
Helixi94 – 963
Turni102 – 1043
Helixi105 – 1084
Turni113 – 1153
Helixi118 – 13417
Turni135 – 1373
Helixi142 – 15918
Turni160 – 1623
Helixi168 – 18417
Helixi193 – 20917
Helixi212 – 22413
Helixi230 – 25425
Helixi264 – 27411
Beta strandi275 – 2784
Helixi283 – 2853
Helixi288 – 31629
Helixi318 – 33114
Turni332 – 3354
Helixi340 – 3456
Helixi347 – 36014
Beta strandi375 – 3773
Beta strandi380 – 3823
Beta strandi387 – 3904
Helixi392 – 3965
Turni399 – 4013
Beta strandi402 – 4043
Helixi410 – 4134
Helixi432 – 4343
Helixi439 – 45618
Beta strandi457 – 4604
Helixi465 – 4673
Beta strandi473 – 4808
Beta strandi486 – 4905

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3IBDX-ray2.00A30-491[»]
3QOAX-ray2.10A27-491[»]
3QU8X-ray2.80A/B/C/D/E/F27-491[»]
3UA5X-ray2.80A/B27-491[»]
4I91X-ray2.00A27-491[»]
ProteinModelPortaliP20813.
SMRiP20813. Positions 42-491.

Miscellaneous databases

EvolutionaryTraceiP20813.

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.

Phylogenomic databases

eggNOGiCOG2124.
HOGENOMiHOG000036992.
HOVERGENiHBG015789.
InParanoidiP20813.
KOiK17709.
OMAiYREIEQV.
OrthoDBiEOG7RBZ85.
PhylomeDBiP20813.
TreeFamiTF352043.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
IPR008068. Cyt_P450_E_grp-I_CYP2B-like.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
PR01685. EP450ICYP2B.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P20813-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MELSVLLFLA LLTGLLLLLV QRHPNTHDRL PPGPRPLPLL GNLLQMDRRG    50
LLKSFLRFRE KYGDVFTVHL GPRPVVMLCG VEAIREALVD KAEAFSGRGK 100
IAMVDPFFRG YGVIFANGNR WKVLRRFSVT TMRDFGMGKR SVEERIQEEA 150
QCLIEELRKS KGALMDPTFL FQSITANIIC SIVFGKRFHY QDQEFLKMLN 200
LFYQTFSLIS SVFGQLFELF SGFLKYFPGA HRQVYKNLQE INAYIGHSVE 250
KHRETLDPSA PKDLIDTYLL HMEKEKSNAH SEFSHQNLNL NTLSLFFAGT 300
ETTSTTLRYG FLLMLKYPHV AERVYREIEQ VIGPHRPPEL HDRAKMPYTE 350
AVIYEIQRFS DLLPMGVPHI VTQHTSFRGY IIPKDTEVFL ILSTALHDPH 400
YFEKPDAFNP DHFLDANGAL KKTEAFIPFS LGKRICLGEG IARAELFLFF 450
TTILQNFSMA SPVAPEDIDL TPQECGVGKI PPTYQIRFLP R 491
Length:491
Mass (Da):56,278
Last modified:February 1, 1991 - v1
Checksum:iB9799164BE8FBF1D
GO
Isoform 2 (identifier: P20813-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLR → MRCMLTNSHPWCGCDWQ
     162-321: Missing.

Note: No experimental confirmation available.

Show »
Length:291
Mass (Da):33,385
Checksum:iA4B40F24ED632B8D
GO

Polymorphismi

Genetic variations in CYP2B6 are responsible for poor metabolism of efavirenz and, therefore, susceptibility to efavirenz toxicity in the central nervous system [MIMi:614546]. Efavirenz is a non-nucleoside reverse transcriptase inhibitor frequently prescribed with 2 nucleoside reverse transcriptase inhibitors as initial therapy for human immunodeficiency virus (HIV) infection. Up to half of patients treated with efavirenz, experience side effects in the central nervous system, including dizziness, insomnia, impaired concentration, somnolence, and abnormal dreams. Severe depression, aggressive behavior, and paranoid or manic reactions may also occur, depending on efavirenz concentration in the plasma.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211Q → L in allele CYP2B6*10. 1 Publication
Corresponds to variant rs34883432 [ dbSNP | Ensembl ].
VAR_023563
Natural varianti22 – 221R → C in allele CYP2B6*2 and allele CYP2B6*10. 6 Publications
Corresponds to variant rs8192709 [ dbSNP | Ensembl ].
VAR_016927
Natural varianti26 – 261T → S.1 Publication
Corresponds to variant rs33973337 [ dbSNP | Ensembl ].
VAR_025206
Natural varianti28 – 281D → G.1 Publication
Corresponds to variant rs33980385 [ dbSNP | Ensembl ].
VAR_025207
Natural varianti29 – 291R → P.
Corresponds to variant rs34284776 [ dbSNP | Ensembl ].
VAR_033819
Natural varianti29 – 291R → S.1 Publication
Corresponds to variant rs33926104 [ dbSNP | Ensembl ].
VAR_025208
Natural varianti46 – 461M → V in allele CYP2B6*11. 1 Publication
Corresponds to variant rs35303484 [ dbSNP | Ensembl ].
VAR_023564
Natural varianti99 – 991G → E in allele CYP2B6*12. 1 Publication
Corresponds to variant rs36060847 [ dbSNP | Ensembl ].
VAR_023565
Natural varianti139 – 1391K → E in allele CYP2B6*8 and allele CYP2B6*13. 2 Publications
Corresponds to variant rs12721655 [ dbSNP | Ensembl ].
VAR_016948
Natural varianti140 – 1401R → Q in allele CYP2B6*14. 1 Publication
Corresponds to variant rs35773040 [ dbSNP | Ensembl ].
VAR_023566
Natural varianti167 – 1671P → A.2 Publications
Corresponds to variant rs3826711 [ dbSNP | Ensembl ].
VAR_016924
Natural varianti172 – 1721Q → H in allele CYP2B6*6, allele CYP2B6*7, allele CYP2B6*9 and allele CYP2B6*13. 8 Publications
Corresponds to variant rs3745274 [ dbSNP | Ensembl ].
VAR_016925
Natural varianti259 – 2591S → R in allele CYP2B6*3. 2 Publications
Corresponds to variant rs45482602 [ dbSNP | Ensembl ].
VAR_016928
Natural varianti262 – 2621K → R in allele CYP2B6*4, allele CYP2B6*6, allele CYP2B6*7 and allele CYP2B6*13; slight decrease in activity. 7 Publications
Corresponds to variant rs2279343 [ dbSNP | Ensembl ].
VAR_016926
Natural varianti289 – 2891N → K.1 Publication
Corresponds to variant rs34277950 [ dbSNP | Ensembl ].
VAR_025209
Natural varianti306 – 3061T → S.1 Publication
Corresponds to variant rs34698757 [ dbSNP | Ensembl ].
VAR_025210
Natural varianti328 – 3281I → T.2 Publications
Corresponds to variant rs28399499 [ dbSNP | Ensembl ].
VAR_024716
Natural varianti391 – 3911I → N in allele CYP2B6*15. 1 Publication
Corresponds to variant rs35979566 [ dbSNP | Ensembl ].
VAR_023567
Natural varianti487 – 4871R → C in allele CYP2B6*5 and allele CYP2B6*7. 6 Publications
Corresponds to variant rs3211371 [ dbSNP | Ensembl ].
VAR_016929

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5757MELSV…KSFLR → MRCMLTNSHPWCGCDWQ in isoform 2.
VSP_055571Add
BLAST
Alternative sequencei162 – 321160Missing in isoform 2.
VSP_055572Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti146 – 1461I → T in AAF13602. 1 Publication
Sequence conflicti238 – 2381L → P in AAF13602. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M29874 mRNA. Translation: AAA52144.1.
AF182277 mRNA. Translation: AAF13602.1.
AK301620 mRNA. Translation: BAG63105.1.
DQ298753 Genomic DNA. Translation: ABB84469.1.
AC023172 Genomic DNA. Translation: AAF32444.1.
AC011541 Genomic DNA. No translation available.
X13494 mRNA. No translation available.
CCDSiCCDS12570.1.
PIRiA32969.
RefSeqiNP_000758.1. NM_000767.4.
UniGeneiHs.1360.

Genome annotation databases

EnsembliENST00000324071; ENSP00000324648; ENSG00000197408.
ENST00000330446; ENSP00000330650; ENSG00000197408.
GeneIDi1555.
KEGGihsa:1555.
UCSCiuc002opr.1. human.

Polymorphism databases

DMDMi117205.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP2B6 alleles

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M29874 mRNA. Translation: AAA52144.1 .
AF182277 mRNA. Translation: AAF13602.1 .
AK301620 mRNA. Translation: BAG63105.1 .
DQ298753 Genomic DNA. Translation: ABB84469.1 .
AC023172 Genomic DNA. Translation: AAF32444.1 .
AC011541 Genomic DNA. No translation available.
X13494 mRNA. No translation available.
CCDSi CCDS12570.1.
PIRi A32969.
RefSeqi NP_000758.1. NM_000767.4.
UniGenei Hs.1360.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3IBD X-ray 2.00 A 30-491 [» ]
3QOA X-ray 2.10 A 27-491 [» ]
3QU8 X-ray 2.80 A/B/C/D/E/F 27-491 [» ]
3UA5 X-ray 2.80 A/B 27-491 [» ]
4I91 X-ray 2.00 A 27-491 [» ]
ProteinModelPortali P20813.
SMRi P20813. Positions 42-491.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107933. 1 interaction.
STRINGi 9606.ENSP00000324648.

Chemistry

BindingDBi P20813.
ChEMBLi CHEMBL4729.
DrugBanki DB01156. Bupropion.
DB00241. Butalbital.
DB00564. Carbamazepine.
DB00758. Clopidogrel.
DB00531. Cyclophosphamide.
DB00625. Efavirenz.
DB01181. Ifosfamide.
DB01043. Memantine.
DB00454. Meperidine.
DB00532. Mephenytoin.
DB00333. Methadone.
DB00849. Methylphenobarbital.
DB00683. Midazolam.
DB00220. Nelfinavir.
DB00238. Nevirapine.
DB00184. Nicotine.
DB01173. Orphenadrine.
DB00252. Phenytoin.
DB00818. Propofol.
DB00503. Ritonavir.
DB01037. Selegiline.
DB01104. Sertraline.
DB00208. Ticlopidine.
DB01361. Troleandomycin.

PTM databases

PhosphoSitei P20813.

Polymorphism databases

DMDMi 117205.

Proteomic databases

PaxDbi P20813.
PRIDEi P20813.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324071 ; ENSP00000324648 ; ENSG00000197408 .
ENST00000330446 ; ENSP00000330650 ; ENSG00000197408 .
GeneIDi 1555.
KEGGi hsa:1555.
UCSCi uc002opr.1. human.

Organism-specific databases

CTDi 1555.
GeneCardsi GC19P041497.
HGNCi HGNC:2615. CYP2B6.
HPAi CAB033866.
HPA048124.
MIMi 123930. gene.
614546. phenotype.
neXtProti NX_P20813.
Orphaneti 240869. Efavirenz toxicity.
240969. Susceptibility to adverse reaction due to efavirenz treatment.
PharmGKBi PA123.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2124.
HOGENOMi HOG000036992.
HOVERGENi HBG015789.
InParanoidi P20813.
KOi K17709.
OMAi YREIEQV.
OrthoDBi EOG7RBZ85.
PhylomeDBi P20813.
TreeFami TF352043.

Enzyme and pathway databases

BioCyci MetaCyc:HS09587-MONOMER.
Reactomei REACT_13543. Xenobiotics.
REACT_13797. CYP2E1 reactions.
REACT_13814. Fatty acids.
SABIO-RK P20813.

Miscellaneous databases

EvolutionaryTracei P20813.
GeneWikii CYP2B6.
GenomeRNAii 1555.
NextBioi 6423.
PROi P20813.
SOURCEi Search...

Gene expression databases

ArrayExpressi P20813.
Bgeei P20813.
CleanExi HS_CYP2B6.
Genevestigatori P20813.

Family and domain databases

Gene3Di 1.10.630.10. 1 hit.
InterProi IPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
IPR008068. Cyt_P450_E_grp-I_CYP2B-like.
[Graphical view ]
Pfami PF00067. p450. 1 hit.
[Graphical view ]
PRINTSi PR00463. EP450I.
PR01685. EP450ICYP2B.
PR00385. P450.
SUPFAMi SSF48264. SSF48264. 1 hit.
PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning and sequence and cDNA-directed expression of human P450 IIB1: identification of a normal and two variant cDNAs derived from the CYP2B locus on chromosome 19 and differential expression of the IIB mRNAs in human liver."
    Yamano S., Nhamburo P.T., Aoyama T., Meyer U.A., Inaba T., Kalow W., Gelboin H.V., McBride O.W., Gonzalez F.J.
    Biochemistry 28:7340-7348(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. "Sequence of a new human cytochrome P450-2B6 cDNA."
    Zhuge J., Qian Y., Xie H., Yu Y.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-167; HIS-172 AND ARG-262.
    Tissue: Liver.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Colon.
  4. NIEHS SNPs program
    Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-22; SER-26; GLY-28; SER-29; HIS-172; ARG-262; LYS-289; SER-306; THR-328 AND CYS-487.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Alternative splicing in the human cytochrome P450IIB6 gene generates a high level of aberrant messages."
    Miles J.S., McLaren A.W., Wolf C.R.
    Nucleic Acids Res. 17:8241-8255(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 26-491 (ISOFORM 1).
  7. "Gene expression in distinct regions of the heart."
    Thum T., Borlak J.
    Lancet 355:979-983(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
    Miyazawa M., Shindo M., Shimada T.
    Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.
  9. "Crystal structure of a cytochrome P450 2B6 genetic variant in complex with the inhibitor 4-(4-chlorophenyl)imidazole at 2.0-A resolution."
    Gay S.C., Shah M.B., Talakad J.C., Maekawa K., Roberts A.G., Wilderman P.R., Sun L., Yang J.Y., Huelga S.C., Hong W.X., Zhang Q., Stout C.D., Halpert J.R.
    Mol. Pharmacol. 77:529-538(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 30-491 OF VARIANT ARG-262 IN COMPLEX WITH HEME AND SYNTHETIC INHIBITOR, FUNCTION, COFACTOR, IDENTIFICATION BY MASS SPECTROMETRY.
  10. "Structures of cytochrome P450 2B6 bound to 4-benzylpyridine and 4-(4-nitrobenzyl)pyridine: insight into inhibitor binding and rearrangement of active site side chains."
    Shah M.B., Pascual J., Zhang Q., Stout C.D., Halpert J.R.
    Mol. Pharmacol. 80:1047-1055(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 30-491 OF VARIANT ARG-262 IN COMPLEX WITH HEME AND SYNTHETIC INHIBITOR, FUNCTION, COFACTOR.
  11. "Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules."
    Shah M.B., Wilderman P.R., Pascual J., Zhang Q., Stout C.D., Halpert J.R.
    Biochemistry 51:7225-7238(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 30-491 IN COMPLEX WITH HEME AND AMLODIPINE, FUNCTION, COFACTOR.
  12. "Pharmacogenetics of efavirenz and central nervous system side effects: an Adult AIDS Clinical Trials Group study."
    Haas D.W., Ribaudo H.J., Kim R.B., Tierney C., Wilkinson G.R., Gulick R.M., Clifford D.B., Hulgan T., Marzolini C., Acosta E.P.
    AIDS 18:2391-2400(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM, INVOLVEMENT IN EFAVIRENZ POOR METABOLISM, SUSCEPTIBILITY TO EFAVIRENZ TOXICITY.
  13. "Haplotype structure of CYP2B6 and association with plasma efavirenz concentrations in a Chilean HIV cohort."
    Carr D.F., la Porte C.J., Pirmohamed M., Owen A., Cortes C.P.
    J. Antimicrob. Chemother. 65:1889-1893(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM, INVOLVEMENT IN EFAVIRENZ POOR METABOLISM, SUSCEPTIBILITY TO EFAVIRENZ TOXICITY.
  14. "Influence of host genetic factors on efavirenz plasma and intracellular pharmacokinetics in HIV-1-infected patients."
    Elens L., Vandercam B., Yombi J.C., Lison D., Wallemacq P., Haufroid V.
    Pharmacogenomics 11:1223-1234(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM, INVOLVEMENT IN EFAVIRENZ POOR METABOLISM, SUSCEPTIBILITY TO EFAVIRENZ TOXICITY.
  15. "A single nucleotide polymorphism of CYP2b6 found in Japanese enhances catalytic activity by autoactivation."
    Ariyoshi N., Miyazaki M., Toide K., Sawamura Y.I., Kamataki T.
    Biochem. Biophys. Res. Commun. 281:1256-1260(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT HIS-172.
  16. "Extensive genetic polymorphism in the human CYP2B6 gene with impact on expression and function in human liver."
    Lang T., Klein K., Fischer J., Nussler A.K., Neuhaus P., Hofmann U., Eichelbaum M., Schwab M., Zanger U.M.
    Pharmacogenetics 11:399-415(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CYS-22; HIS-172; ARG-259; ARG-262 AND CYS-487.
  17. "Functional characterization of cytochrome P450 2B6 allelic variants."
    Jinno H., Tanaka-Kagawa T., Ohno A., Makino Y., Matsushima E., Hanioka N., Ando M.
    Drug Metab. Dispos. 31:398-403(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF VARIANTS CYS-22; HIS-172; ARG-259; ARG-262 AND CYS-487.
  18. "Catalog of 680 variations among eight cytochrome p450 (CYP) genes, nine esterase genes, and two other genes in the Japanese population."
    Saito S., Iida A., Sekine A., Kawauchi S., Higuchi S., Ogawa C., Nakamura Y.
    J. Hum. Genet. 48:249-270(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CYS-22; ALA-167; HIS-172 AND CYS-487.
  19. "Hepatic CYP2B6 expression: gender and ethnic differences and relationship to CYP2B6 genotype and CAR (constitutive androstane receptor) expression."
    Lamba V., Lamba J., Yasuda K., Strom S., Davila J., Hancock M.L., Fackenthal J.D., Rogan P.K., Ring B., Wrighton S.A., Schuetz E.G.
    J. Pharmacol. Exp. Ther. 307:906-922(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CYS-22; GLU-139; HIS-172 AND CYS-487.
  20. "Multiple novel nonsynonymous CYP2B6 gene polymorphisms in Caucasians: demonstration of phenotypic null alleles."
    Lang T., Klein K., Richter T., Zibat A., Kerb R., Eichelbaum M., Schwab M., Zanger U.M.
    J. Pharmacol. Exp. Ther. 311:34-43(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS LEU-21; VAL-46; GLU-99; GLU-139; GLN-140 AND ASN-391.
  21. "Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population."
    Solus J.F., Arietta B.J., Harris J.R., Sexton D.P., Steward J.Q., McMunn C., Ihrie P., Mehall J.M., Edwards T.L., Dawson E.P.
    Pharmacogenomics 5:895-931(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CYS-22; HIS-172; ARG-262; THR-328 AND CYS-487.

Entry informationi

Entry nameiCP2B6_HUMAN
AccessioniPrimary (citable) accession number: P20813
Secondary accession number(s): B4DWP3, Q2V565, Q9UK46
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: September 3, 2014
This is version 158 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi