Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P20813

- CP2B6_HUMAN

UniProt

P20813 - CP2B6_HUMAN

Protein

Cytochrome P450 2B6

Gene

CYP2B6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 159 (01 Oct 2014)
      Sequence version 1 (01 Feb 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,4-cineole 2-exo-monooxygenase.4 Publications

    Catalytic activityi

    1,4-cineole + NADPH + O2 = 2-exo-hydroxy-1,4-cineole + NADP+ + H2O.1 Publication

    Cofactori

    Heme group.3 Publications

    Kineticsi

    1. KM=360 µM for 1,4-cineole1 Publication

    Vmax=3.4 nmol/min/nmol enzyme toward 2-exo-hydroxy-1,4-cineole1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi436 – 4361Iron (heme axial ligand)

    GO - Molecular functioni

    1. heme binding Source: UniProtKB
    2. iron ion binding Source: InterPro
    3. monooxygenase activity Source: BHF-UCL
    4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro
    5. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen Source: InterPro

    GO - Biological processi

    1. cellular ketone metabolic process Source: BHF-UCL
    2. drug metabolic process Source: BHF-UCL
    3. exogenous drug catabolic process Source: BHF-UCL
    4. oxidation-reduction process Source: BHF-UCL
    5. small molecule metabolic process Source: Reactome
    6. steroid metabolic process Source: BHF-UCL
    7. xenobiotic metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Monooxygenase, Oxidoreductase

    Keywords - Ligandi

    Heme, Iron, Metal-binding, NADP

    Enzyme and pathway databases

    BioCyciMetaCyc:HS09587-MONOMER.
    ReactomeiREACT_13543. Xenobiotics.
    REACT_13797. CYP2E1 reactions.
    REACT_13814. Fatty acids.
    SABIO-RKP20813.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome P450 2B6 (EC:1.14.13.-)
    Alternative name(s):
    1,4-cineole 2-exo-monooxygenase
    CYPIIB6
    Cytochrome P450 IIB1
    Gene namesi
    Name:CYP2B6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:2615. CYP2B6.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: Reactome

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    MIMi614546. phenotype.
    Orphaneti240869. Efavirenz toxicity.
    240969. Susceptibility to adverse reaction due to efavirenz treatment.
    PharmGKBiPA123.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 491491Cytochrome P450 2B6PRO_0000051683Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei128 – 1281Phosphoserine; by PKABy similarity

    Post-translational modificationi

    Phosphorylation is accompanied by a decrease in enzyme activity.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP20813.
    PRIDEiP20813.

    PTM databases

    PhosphoSiteiP20813.

    Expressioni

    Tissue specificityi

    Expressed in liver, lung and heart right ventricle.1 Publication

    Inductioni

    By phenobarbital.

    Gene expression databases

    ArrayExpressiP20813.
    BgeeiP20813.
    CleanExiHS_CYP2B6.
    GenevestigatoriP20813.

    Organism-specific databases

    HPAiCAB033866.
    HPA048124.

    Interactioni

    Protein-protein interaction databases

    BioGridi107933. 1 interaction.
    STRINGi9606.ENSP00000324648.

    Structurei

    Secondary structure

    1
    491
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni38 – 403
    Helixi43 – 453
    Helixi51 – 6212
    Beta strandi64 – 707
    Beta strandi73 – 786
    Helixi81 – 888
    Turni89 – 935
    Helixi94 – 963
    Turni102 – 1043
    Helixi105 – 1084
    Turni113 – 1153
    Helixi118 – 13417
    Turni135 – 1373
    Helixi142 – 15918
    Turni160 – 1623
    Helixi168 – 18417
    Helixi193 – 20917
    Helixi212 – 22413
    Helixi230 – 25425
    Helixi264 – 27411
    Beta strandi275 – 2784
    Helixi283 – 2853
    Helixi288 – 31629
    Helixi318 – 33114
    Turni332 – 3354
    Helixi340 – 3456
    Helixi347 – 36014
    Beta strandi375 – 3773
    Beta strandi380 – 3823
    Beta strandi387 – 3904
    Helixi392 – 3965
    Turni399 – 4013
    Beta strandi402 – 4043
    Helixi410 – 4134
    Helixi432 – 4343
    Helixi439 – 45618
    Beta strandi457 – 4604
    Helixi465 – 4673
    Beta strandi473 – 4808
    Beta strandi486 – 4905

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3IBDX-ray2.00A30-491[»]
    3QOAX-ray2.10A27-491[»]
    3QU8X-ray2.80A/B/C/D/E/F27-491[»]
    3UA5X-ray2.80A/B27-491[»]
    4I91X-ray2.00A27-491[»]
    ProteinModelPortaliP20813.
    SMRiP20813. Positions 42-491.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP20813.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytochrome P450 family.Curated

    Phylogenomic databases

    eggNOGiCOG2124.
    HOGENOMiHOG000036992.
    HOVERGENiHBG015789.
    InParanoidiP20813.
    KOiK17709.
    OMAiYREIEQV.
    OrthoDBiEOG7RBZ85.
    PhylomeDBiP20813.
    TreeFamiTF352043.

    Family and domain databases

    Gene3Di1.10.630.10. 1 hit.
    InterProiIPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR002401. Cyt_P450_E_grp-I.
    IPR008068. Cyt_P450_E_grp-I_CYP2B-like.
    [Graphical view]
    PfamiPF00067. p450. 1 hit.
    [Graphical view]
    PRINTSiPR00463. EP450I.
    PR01685. EP450ICYP2B.
    PR00385. P450.
    SUPFAMiSSF48264. SSF48264. 1 hit.
    PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P20813-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELSVLLFLA LLTGLLLLLV QRHPNTHDRL PPGPRPLPLL GNLLQMDRRG    50
    LLKSFLRFRE KYGDVFTVHL GPRPVVMLCG VEAIREALVD KAEAFSGRGK 100
    IAMVDPFFRG YGVIFANGNR WKVLRRFSVT TMRDFGMGKR SVEERIQEEA 150
    QCLIEELRKS KGALMDPTFL FQSITANIIC SIVFGKRFHY QDQEFLKMLN 200
    LFYQTFSLIS SVFGQLFELF SGFLKYFPGA HRQVYKNLQE INAYIGHSVE 250
    KHRETLDPSA PKDLIDTYLL HMEKEKSNAH SEFSHQNLNL NTLSLFFAGT 300
    ETTSTTLRYG FLLMLKYPHV AERVYREIEQ VIGPHRPPEL HDRAKMPYTE 350
    AVIYEIQRFS DLLPMGVPHI VTQHTSFRGY IIPKDTEVFL ILSTALHDPH 400
    YFEKPDAFNP DHFLDANGAL KKTEAFIPFS LGKRICLGEG IARAELFLFF 450
    TTILQNFSMA SPVAPEDIDL TPQECGVGKI PPTYQIRFLP R 491
    Length:491
    Mass (Da):56,278
    Last modified:February 1, 1991 - v1
    Checksum:iB9799164BE8FBF1D
    GO
    Isoform 2 (identifier: P20813-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLR → MRCMLTNSHPWCGCDWQ
         162-321: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:291
    Mass (Da):33,385
    Checksum:iA4B40F24ED632B8D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti146 – 1461I → T in AAF13602. 1 PublicationCurated
    Sequence conflicti238 – 2381L → P in AAF13602. 1 PublicationCurated

    Polymorphismi

    Genetic variations in CYP2B6 are responsible for poor metabolism of efavirenz and, therefore, susceptibility to efavirenz toxicity in the central nervous system [MIMi:614546]. Efavirenz is a non-nucleoside reverse transcriptase inhibitor frequently prescribed with 2 nucleoside reverse transcriptase inhibitors as initial therapy for human immunodeficiency virus (HIV) infection. Up to half of patients treated with efavirenz, experience side effects in the central nervous system, including dizziness, insomnia, impaired concentration, somnolence, and abnormal dreams. Severe depression, aggressive behavior, and paranoid or manic reactions may also occur, depending on efavirenz concentration in the plasma.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti21 – 211Q → L in allele CYP2B6*10. 1 Publication
    Corresponds to variant rs34883432 [ dbSNP | Ensembl ].
    VAR_023563
    Natural varianti22 – 221R → C in allele CYP2B6*2 and allele CYP2B6*10. 5 Publications
    Corresponds to variant rs8192709 [ dbSNP | Ensembl ].
    VAR_016927
    Natural varianti26 – 261T → S.1 Publication
    Corresponds to variant rs33973337 [ dbSNP | Ensembl ].
    VAR_025206
    Natural varianti28 – 281D → G.1 Publication
    Corresponds to variant rs33980385 [ dbSNP | Ensembl ].
    VAR_025207
    Natural varianti29 – 291R → P.
    Corresponds to variant rs34284776 [ dbSNP | Ensembl ].
    VAR_033819
    Natural varianti29 – 291R → S.1 Publication
    Corresponds to variant rs33926104 [ dbSNP | Ensembl ].
    VAR_025208
    Natural varianti46 – 461M → V in allele CYP2B6*11. 1 Publication
    Corresponds to variant rs35303484 [ dbSNP | Ensembl ].
    VAR_023564
    Natural varianti99 – 991G → E in allele CYP2B6*12. 1 Publication
    Corresponds to variant rs36060847 [ dbSNP | Ensembl ].
    VAR_023565
    Natural varianti139 – 1391K → E in allele CYP2B6*8 and allele CYP2B6*13. 2 Publications
    Corresponds to variant rs12721655 [ dbSNP | Ensembl ].
    VAR_016948
    Natural varianti140 – 1401R → Q in allele CYP2B6*14. 1 Publication
    Corresponds to variant rs35773040 [ dbSNP | Ensembl ].
    VAR_023566
    Natural varianti167 – 1671P → A.2 Publications
    Corresponds to variant rs3826711 [ dbSNP | Ensembl ].
    VAR_016924
    Natural varianti172 – 1721Q → H in allele CYP2B6*6, allele CYP2B6*7, allele CYP2B6*9 and allele CYP2B6*13. 7 Publications
    Corresponds to variant rs3745274 [ dbSNP | Ensembl ].
    VAR_016925
    Natural varianti259 – 2591S → R in allele CYP2B6*3. 1 Publication
    Corresponds to variant rs45482602 [ dbSNP | Ensembl ].
    VAR_016928
    Natural varianti262 – 2621K → R in allele CYP2B6*4, allele CYP2B6*6, allele CYP2B6*7 and allele CYP2B6*13; slight decrease in activity. 4 Publications
    Corresponds to variant rs2279343 [ dbSNP | Ensembl ].
    VAR_016926
    Natural varianti289 – 2891N → K.1 Publication
    Corresponds to variant rs34277950 [ dbSNP | Ensembl ].
    VAR_025209
    Natural varianti306 – 3061T → S.1 Publication
    Corresponds to variant rs34698757 [ dbSNP | Ensembl ].
    VAR_025210
    Natural varianti328 – 3281I → T.2 Publications
    Corresponds to variant rs28399499 [ dbSNP | Ensembl ].
    VAR_024716
    Natural varianti391 – 3911I → N in allele CYP2B6*15. 1 Publication
    Corresponds to variant rs35979566 [ dbSNP | Ensembl ].
    VAR_023567
    Natural varianti487 – 4871R → C in allele CYP2B6*5 and allele CYP2B6*7. 5 Publications
    Corresponds to variant rs3211371 [ dbSNP | Ensembl ].
    VAR_016929

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5757MELSV…KSFLR → MRCMLTNSHPWCGCDWQ in isoform 2. 1 PublicationVSP_055571Add
    BLAST
    Alternative sequencei162 – 321160Missing in isoform 2. 1 PublicationVSP_055572Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M29874 mRNA. Translation: AAA52144.1.
    AF182277 mRNA. Translation: AAF13602.1.
    AK301620 mRNA. Translation: BAG63105.1.
    DQ298753 Genomic DNA. Translation: ABB84469.1.
    AC023172 Genomic DNA. Translation: AAF32444.1.
    AC011541 Genomic DNA. No translation available.
    X13494 mRNA. No translation available.
    CCDSiCCDS12570.1.
    PIRiA32969.
    RefSeqiNP_000758.1. NM_000767.4.
    UniGeneiHs.1360.

    Genome annotation databases

    EnsembliENST00000324071; ENSP00000324648; ENSG00000197408. [P20813-1]
    GeneIDi1555.
    KEGGihsa:1555.
    UCSCiuc002opr.1. human.

    Polymorphism databases

    DMDMi117205.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Cytochrome P450 Allele Nomenclature Committee

    CYP2B6 alleles

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M29874 mRNA. Translation: AAA52144.1 .
    AF182277 mRNA. Translation: AAF13602.1 .
    AK301620 mRNA. Translation: BAG63105.1 .
    DQ298753 Genomic DNA. Translation: ABB84469.1 .
    AC023172 Genomic DNA. Translation: AAF32444.1 .
    AC011541 Genomic DNA. No translation available.
    X13494 mRNA. No translation available.
    CCDSi CCDS12570.1.
    PIRi A32969.
    RefSeqi NP_000758.1. NM_000767.4.
    UniGenei Hs.1360.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3IBD X-ray 2.00 A 30-491 [» ]
    3QOA X-ray 2.10 A 27-491 [» ]
    3QU8 X-ray 2.80 A/B/C/D/E/F 27-491 [» ]
    3UA5 X-ray 2.80 A/B 27-491 [» ]
    4I91 X-ray 2.00 A 27-491 [» ]
    ProteinModelPortali P20813.
    SMRi P20813. Positions 42-491.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107933. 1 interaction.
    STRINGi 9606.ENSP00000324648.

    Chemistry

    BindingDBi P20813.
    ChEMBLi CHEMBL4729.
    DrugBanki DB01156. Bupropion.
    DB00241. Butalbital.
    DB00564. Carbamazepine.
    DB00758. Clopidogrel.
    DB00531. Cyclophosphamide.
    DB00625. Efavirenz.
    DB01181. Ifosfamide.
    DB01043. Memantine.
    DB00454. Meperidine.
    DB00532. Mephenytoin.
    DB00333. Methadone.
    DB00849. Methylphenobarbital.
    DB00683. Midazolam.
    DB00220. Nelfinavir.
    DB00238. Nevirapine.
    DB00184. Nicotine.
    DB01173. Orphenadrine.
    DB00252. Phenytoin.
    DB00818. Propofol.
    DB00503. Ritonavir.
    DB01037. Selegiline.
    DB01104. Sertraline.
    DB00208. Ticlopidine.
    DB01361. Troleandomycin.

    PTM databases

    PhosphoSitei P20813.

    Polymorphism databases

    DMDMi 117205.

    Proteomic databases

    PaxDbi P20813.
    PRIDEi P20813.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000324071 ; ENSP00000324648 ; ENSG00000197408 . [P20813-1 ]
    GeneIDi 1555.
    KEGGi hsa:1555.
    UCSCi uc002opr.1. human.

    Organism-specific databases

    CTDi 1555.
    GeneCardsi GC19P041497.
    HGNCi HGNC:2615. CYP2B6.
    HPAi CAB033866.
    HPA048124.
    MIMi 123930. gene.
    614546. phenotype.
    neXtProti NX_P20813.
    Orphaneti 240869. Efavirenz toxicity.
    240969. Susceptibility to adverse reaction due to efavirenz treatment.
    PharmGKBi PA123.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2124.
    HOGENOMi HOG000036992.
    HOVERGENi HBG015789.
    InParanoidi P20813.
    KOi K17709.
    OMAi YREIEQV.
    OrthoDBi EOG7RBZ85.
    PhylomeDBi P20813.
    TreeFami TF352043.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS09587-MONOMER.
    Reactomei REACT_13543. Xenobiotics.
    REACT_13797. CYP2E1 reactions.
    REACT_13814. Fatty acids.
    SABIO-RK P20813.

    Miscellaneous databases

    EvolutionaryTracei P20813.
    GeneWikii CYP2B6.
    GenomeRNAii 1555.
    NextBioi 6423.
    PROi P20813.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P20813.
    Bgeei P20813.
    CleanExi HS_CYP2B6.
    Genevestigatori P20813.

    Family and domain databases

    Gene3Di 1.10.630.10. 1 hit.
    InterProi IPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR002401. Cyt_P450_E_grp-I.
    IPR008068. Cyt_P450_E_grp-I_CYP2B-like.
    [Graphical view ]
    Pfami PF00067. p450. 1 hit.
    [Graphical view ]
    PRINTSi PR00463. EP450I.
    PR01685. EP450ICYP2B.
    PR00385. P450.
    SUPFAMi SSF48264. SSF48264. 1 hit.
    PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning and sequence and cDNA-directed expression of human P450 IIB1: identification of a normal and two variant cDNAs derived from the CYP2B locus on chromosome 19 and differential expression of the IIB mRNAs in human liver."
      Yamano S., Nhamburo P.T., Aoyama T., Meyer U.A., Inaba T., Kalow W., Gelboin H.V., McBride O.W., Gonzalez F.J.
      Biochemistry 28:7340-7348(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. "Sequence of a new human cytochrome P450-2B6 cDNA."
      Zhuge J., Qian Y., Xie H., Yu Y.
      Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ALA-167; HIS-172 AND ARG-262.
      Tissue: Liver.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Colon.
    4. NIEHS SNPs program
      Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-22; SER-26; GLY-28; SER-29; HIS-172; ARG-262; LYS-289; SER-306; THR-328 AND CYS-487.
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Alternative splicing in the human cytochrome P450IIB6 gene generates a high level of aberrant messages."
      Miles J.S., McLaren A.W., Wolf C.R.
      Nucleic Acids Res. 17:8241-8255(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 26-491 (ISOFORM 1).
    7. "Gene expression in distinct regions of the heart."
      Thum T., Borlak J.
      Lancet 355:979-983(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. "Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes."
      Miyazawa M., Shindo M., Shimada T.
      Xenobiotica 31:713-723(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: CATALYTIC ACTIVITY, FUNCTION AS 1,4-CINEOLE 2-EXO-MONOOXYGENASE, BIOPHYSICOCHEMICAL PROPERTIES.
    9. "Crystal structure of a cytochrome P450 2B6 genetic variant in complex with the inhibitor 4-(4-chlorophenyl)imidazole at 2.0-A resolution."
      Gay S.C., Shah M.B., Talakad J.C., Maekawa K., Roberts A.G., Wilderman P.R., Sun L., Yang J.Y., Huelga S.C., Hong W.X., Zhang Q., Stout C.D., Halpert J.R.
      Mol. Pharmacol. 77:529-538(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 30-491 OF VARIANT ARG-262 IN COMPLEX WITH HEME AND SYNTHETIC INHIBITOR, FUNCTION, COFACTOR, IDENTIFICATION BY MASS SPECTROMETRY.
    10. "Structures of cytochrome P450 2B6 bound to 4-benzylpyridine and 4-(4-nitrobenzyl)pyridine: insight into inhibitor binding and rearrangement of active site side chains."
      Shah M.B., Pascual J., Zhang Q., Stout C.D., Halpert J.R.
      Mol. Pharmacol. 80:1047-1055(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 30-491 OF VARIANT ARG-262 IN COMPLEX WITH HEME AND SYNTHETIC INHIBITOR, FUNCTION, COFACTOR.
    11. "Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules."
      Shah M.B., Wilderman P.R., Pascual J., Zhang Q., Stout C.D., Halpert J.R.
      Biochemistry 51:7225-7238(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 30-491 IN COMPLEX WITH HEME AND AMLODIPINE, FUNCTION, COFACTOR.
    12. "Pharmacogenetics of efavirenz and central nervous system side effects: an Adult AIDS Clinical Trials Group study."
      Haas D.W., Ribaudo H.J., Kim R.B., Tierney C., Wilkinson G.R., Gulick R.M., Clifford D.B., Hulgan T., Marzolini C., Acosta E.P.
      AIDS 18:2391-2400(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: POLYMORPHISM, INVOLVEMENT IN EFAVIRENZ POOR METABOLISM, SUSCEPTIBILITY TO EFAVIRENZ TOXICITY.
    13. "Haplotype structure of CYP2B6 and association with plasma efavirenz concentrations in a Chilean HIV cohort."
      Carr D.F., la Porte C.J., Pirmohamed M., Owen A., Cortes C.P.
      J. Antimicrob. Chemother. 65:1889-1893(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: POLYMORPHISM, INVOLVEMENT IN EFAVIRENZ POOR METABOLISM, SUSCEPTIBILITY TO EFAVIRENZ TOXICITY.
    14. "Influence of host genetic factors on efavirenz plasma and intracellular pharmacokinetics in HIV-1-infected patients."
      Elens L., Vandercam B., Yombi J.C., Lison D., Wallemacq P., Haufroid V.
      Pharmacogenomics 11:1223-1234(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: POLYMORPHISM, INVOLVEMENT IN EFAVIRENZ POOR METABOLISM, SUSCEPTIBILITY TO EFAVIRENZ TOXICITY.
    15. "A single nucleotide polymorphism of CYP2b6 found in Japanese enhances catalytic activity by autoactivation."
      Ariyoshi N., Miyazaki M., Toide K., Sawamura Y.I., Kamataki T.
      Biochem. Biophys. Res. Commun. 281:1256-1260(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT HIS-172.
    16. "Extensive genetic polymorphism in the human CYP2B6 gene with impact on expression and function in human liver."
      Lang T., Klein K., Fischer J., Nussler A.K., Neuhaus P., Hofmann U., Eichelbaum M., Schwab M., Zanger U.M.
      Pharmacogenetics 11:399-415(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CYS-22; HIS-172; ARG-259; ARG-262 AND CYS-487.
    17. "Functional characterization of cytochrome P450 2B6 allelic variants."
      Jinno H., Tanaka-Kagawa T., Ohno A., Makino Y., Matsushima E., Hanioka N., Ando M.
      Drug Metab. Dispos. 31:398-403(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF VARIANTS CYS-22; HIS-172; ARG-259; ARG-262 AND CYS-487.
    18. "Catalog of 680 variations among eight cytochrome p450 (CYP) genes, nine esterase genes, and two other genes in the Japanese population."
      Saito S., Iida A., Sekine A., Kawauchi S., Higuchi S., Ogawa C., Nakamura Y.
      J. Hum. Genet. 48:249-270(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CYS-22; ALA-167; HIS-172 AND CYS-487.
    19. "Hepatic CYP2B6 expression: gender and ethnic differences and relationship to CYP2B6 genotype and CAR (constitutive androstane receptor) expression."
      Lamba V., Lamba J., Yasuda K., Strom S., Davila J., Hancock M.L., Fackenthal J.D., Rogan P.K., Ring B., Wrighton S.A., Schuetz E.G.
      J. Pharmacol. Exp. Ther. 307:906-922(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CYS-22; GLU-139; HIS-172 AND CYS-487.
    20. "Multiple novel nonsynonymous CYP2B6 gene polymorphisms in Caucasians: demonstration of phenotypic null alleles."
      Lang T., Klein K., Richter T., Zibat A., Kerb R., Eichelbaum M., Schwab M., Zanger U.M.
      J. Pharmacol. Exp. Ther. 311:34-43(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS LEU-21; VAL-46; GLU-99; GLU-139; GLN-140 AND ASN-391.
    21. "Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population."
      Solus J.F., Arietta B.J., Harris J.R., Sexton D.P., Steward J.Q., McMunn C., Ihrie P., Mehall J.M., Edwards T.L., Dawson E.P.
      Pharmacogenomics 5:895-931(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CYS-22; HIS-172; ARG-262; THR-328 AND CYS-487.

    Entry informationi

    Entry nameiCP2B6_HUMAN
    AccessioniPrimary (citable) accession number: P20813
    Secondary accession number(s): B4DWP3, Q2V565, Q9UK46
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1991
    Last sequence update: February 1, 1991
    Last modified: October 1, 2014
    This is version 159 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3