Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 2B6

Gene

CYP2B6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,4-cineole 2-exo-monooxygenase.4 Publications

Catalytic activityi

1,4-cineole + NADPH + O2 = 2-exo-hydroxy-1,4-cineole + NADP+ + H2O.1 Publication

Cofactori

heme3 Publications

Kineticsi

  1. KM=360 µM for 1,4-cineole1 Publication
  1. Vmax=3.4 nmol/min/nmol enzyme toward 2-exo-hydroxy-1,4-cineole1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi436Iron (heme axial ligand)1

GO - Molecular functioni

GO - Biological processi

  • cellular ketone metabolic process Source: BHF-UCL
  • drug metabolic process Source: BHF-UCL
  • epoxygenase P450 pathway Source: GO_Central
  • exogenous drug catabolic process Source: BHF-UCL
  • oxidation-reduction process Source: BHF-UCL
  • steroid metabolic process Source: BHF-UCL
  • xenobiotic metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCyciMetaCyc:HS09587-MONOMER.
ZFISH:HS09587-MONOMER.
BRENDAi1.14.14.1. 2681.
ReactomeiR-HSA-211935. Fatty acids.
R-HSA-211981. Xenobiotics.
R-HSA-211999. CYP2E1 reactions.
SABIO-RKP20813.

Chemistry databases

SwissLipidsiSLP:000001346.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 2B6 (EC:1.14.13.-)
Alternative name(s):
1,4-cineole 2-exo-monooxygenase
CYPIIB6
Cytochrome P450 IIB1
Gene namesi
Name:CYP2B6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:2615. CYP2B6.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi1555.
MalaCardsiCYP2B6.
MIMi614546. phenotype.
OpenTargetsiENSG00000197408.
Orphaneti240869. Efavirenz toxicity.
PharmGKBiPA123.

Chemistry databases

ChEMBLiCHEMBL4729.
DrugBankiDB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB01435. Antipyrine.
DB06413. Armodafinil.
DB06697. Artemether.
DB01076. Atorvastatin.
DB00972. Azelastine.
DB00865. Benzphetamine.
DB06770. Benzyl alcohol.
DB04794. Bifonazole.
DB00835. Brompheniramine.
DB01156. Bupropion.
DB00564. Carbamazepine.
DB00748. Carbinoxamine.
DB00169. Cholecalciferol.
DB00568. Cinnarizine.
DB00604. Cisapride.
DB00515. Cisplatin.
DB00215. Citalopram.
DB00349. Clobazam.
DB00636. Clofibrate.
DB00758. Clopidogrel.
DB01559. Clotiazepam.
DB00257. Clotrimazole.
DB01394. Colchicine.
DB00531. Cyclophosphamide.
DB01151. Desipramine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00586. Diclofenac.
DB01075. Diphenhydramine.
DB01184. Domperidone.
DB00997. Doxorubicin.
DB00625. Efavirenz.
DB08899. Enzalutamide.
DB00751. Epinastine.
DB00199. Erythromycin.
DB00655. Estrone.
DB00898. Ethanol.
DB01466. Ethylmorphine.
DB04841. Flunarizine.
DB01544. Flunitrazepam.
DB00472. Fluoxetine.
DB01095. Fluvastatin.
DB00176. Fluvoxamine.
DB01320. Fosphenytoin.
DB01159. Halothane.
DB09054. Idelalisib.
DB01181. Ifosfamide.
DB00458. Imipramine.
DB00762. Irinotecan.
DB00753. Isoflurane.
DB01167. Itraconazole.
DB09570. Ixazomib.
DB01221. Ketamine.
DB06738. Ketobemidone.
DB01026. Ketoconazole.
DB00281. Lidocaine.
DB00836. Loperamide.
DB01601. Lopinavir.
DB04871. Lorcaserin.
DB00772. Malathion.
DB01043. Memantine.
DB00333. Methadone.
DB00763. Methimazole.
DB01028. Methoxyflurane.
DB00849. Methylphenobarbital.
DB06710. Methyltestosterone.
DB00379. Mexiletine.
DB06148. Mianserin.
DB01110. Miconazole.
DB00683. Midazolam.
DB00745. Modafinil.
DB00220. Nelfinavir.
DB00238. Nevirapine.
DB00622. Nicardipine.
DB00184. Nicotine.
DB01115. Nifedipine.
DB04868. Nilotinib.
DB00435. Nitric Oxide.
DB09074. Olaparib.
DB01173. Orphenadrine.
DB04938. Ospemifene.
DB00715. Paroxetine.
DB01074. Perhexiline.
DB04930. Permethrin.
DB00850. Perphenazine.
DB00454. Pethidine.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB06209. Prasugrel.
DB00794. Primidone.
DB01069. Promethazine.
DB00818. Propofol.
DB00908. Quinidine.
DB00481. Raloxifene.
DB08896. Regorafenib.
DB01045. Rifampicin.
DB08864. Rilpivirine.
DB00503. Ritonavir.
DB06176. Romidepsin.
DB00296. Ropivacaine.
DB00778. Roxithromycin.
DB01037. Selegiline.
DB01104. Sertraline.
DB01236. Sevoflurane.
DB00641. Simvastatin.
DB00398. Sorafenib.
DB06729. Sulfaphenazole.
DB01138. Sulfinpyrazone.
DB00675. Tamoxifen.
DB00231. Temazepam.
DB00624. Testosterone.
DB04572. Thiotepa.
DB00208. Ticlopidine.
DB00193. Tramadol.
DB00755. Tretinoin.
DB00313. Valproic Acid.
DB00285. Venlafaxine.
DB00661. Verapamil.
DB09068. Vortioxetine.
GuidetoPHARMACOLOGYi1324.

Polymorphism and mutation databases

BioMutaiCYP2B6.
DMDMi117205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000516831 – 491Cytochrome P450 2B6Add BLAST491

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei128Phosphoserine; by PKABy similarity1

Post-translational modificationi

Phosphorylation is accompanied by a decrease in enzyme activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP20813.
PeptideAtlasiP20813.
PRIDEiP20813.

PTM databases

iPTMnetiP20813.
PhosphoSitePlusiP20813.

Expressioni

Tissue specificityi

Expressed in liver, lung and heart right ventricle.1 Publication

Inductioni

By phenobarbital.

Gene expression databases

BgeeiENSG00000197408.
CleanExiHS_CYP2B6.
ExpressionAtlasiP20813. baseline and differential.
GenevisibleiP20813. HS.

Organism-specific databases

HPAiCAB033866.
HPA048124.

Interactioni

Protein-protein interaction databases

BioGridi107933. 4 interactors.
STRINGi9606.ENSP00000324648.

Chemistry databases

BindingDBiP20813.

Structurei

Secondary structure

1491
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni38 – 40Combined sources3
Helixi43 – 45Combined sources3
Helixi51 – 62Combined sources12
Beta strandi64 – 70Combined sources7
Beta strandi73 – 78Combined sources6
Helixi81 – 88Combined sources8
Turni89 – 93Combined sources5
Helixi94 – 96Combined sources3
Turni102 – 104Combined sources3
Helixi105 – 108Combined sources4
Turni113 – 115Combined sources3
Helixi118 – 134Combined sources17
Turni135 – 137Combined sources3
Helixi142 – 159Combined sources18
Turni160 – 162Combined sources3
Helixi168 – 184Combined sources17
Helixi193 – 209Combined sources17
Helixi212 – 224Combined sources13
Helixi230 – 254Combined sources25
Helixi264 – 274Combined sources11
Beta strandi275 – 278Combined sources4
Helixi283 – 285Combined sources3
Helixi288 – 316Combined sources29
Helixi318 – 331Combined sources14
Turni332 – 335Combined sources4
Helixi340 – 345Combined sources6
Helixi347 – 360Combined sources14
Beta strandi375 – 377Combined sources3
Beta strandi380 – 382Combined sources3
Beta strandi387 – 390Combined sources4
Helixi392 – 396Combined sources5
Turni399 – 401Combined sources3
Beta strandi402 – 404Combined sources3
Helixi410 – 413Combined sources4
Helixi432 – 434Combined sources3
Helixi439 – 456Combined sources18
Beta strandi457 – 460Combined sources4
Helixi465 – 467Combined sources3
Beta strandi473 – 480Combined sources8
Beta strandi486 – 490Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IBDX-ray2.00A30-491[»]
3QOAX-ray2.10A27-491[»]
3QU8X-ray2.80A/B/C/D/E/F27-491[»]
3UA5X-ray2.80A/B27-491[»]
4I91X-ray2.00A27-491[»]
4RQLX-ray2.10A/B27-491[»]
4RRTX-ray2.20A/B27-491[»]
4ZV8X-ray2.24A30-491[»]
ProteinModelPortaliP20813.
SMRiP20813.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP20813.

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiKOG0156. Eukaryota.
COG2124. LUCA.
GeneTreeiENSGT00760000118775.
HOGENOMiHOG000036992.
HOVERGENiHBG015789.
InParanoidiP20813.
KOiK17709.
OMAiYREIEQV.
OrthoDBiEOG091G0BT8.
PhylomeDBiP20813.
TreeFamiTF352043.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
IPR008068. Cyt_P450_E_grp-I_CYP2B-like.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
PR01685. EP450ICYP2B.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P20813-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELSVLLFLA LLTGLLLLLV QRHPNTHDRL PPGPRPLPLL GNLLQMDRRG
60 70 80 90 100
LLKSFLRFRE KYGDVFTVHL GPRPVVMLCG VEAIREALVD KAEAFSGRGK
110 120 130 140 150
IAMVDPFFRG YGVIFANGNR WKVLRRFSVT TMRDFGMGKR SVEERIQEEA
160 170 180 190 200
QCLIEELRKS KGALMDPTFL FQSITANIIC SIVFGKRFHY QDQEFLKMLN
210 220 230 240 250
LFYQTFSLIS SVFGQLFELF SGFLKYFPGA HRQVYKNLQE INAYIGHSVE
260 270 280 290 300
KHRETLDPSA PKDLIDTYLL HMEKEKSNAH SEFSHQNLNL NTLSLFFAGT
310 320 330 340 350
ETTSTTLRYG FLLMLKYPHV AERVYREIEQ VIGPHRPPEL HDRAKMPYTE
360 370 380 390 400
AVIYEIQRFS DLLPMGVPHI VTQHTSFRGY IIPKDTEVFL ILSTALHDPH
410 420 430 440 450
YFEKPDAFNP DHFLDANGAL KKTEAFIPFS LGKRICLGEG IARAELFLFF
460 470 480 490
TTILQNFSMA SPVAPEDIDL TPQECGVGKI PPTYQIRFLP R
Length:491
Mass (Da):56,278
Last modified:February 1, 1991 - v1
Checksum:iB9799164BE8FBF1D
GO
Isoform 2 (identifier: P20813-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLR → MRCMLTNSHPWCGCDWQ
     162-321: Missing.

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):33,385
Checksum:iA4B40F24ED632B8D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti146I → T in AAF13602 (Ref. 2) Curated1
Sequence conflicti238L → P in AAF13602 (Ref. 2) Curated1

Polymorphismi

Genetic variations in CYP2B6 are responsible for poor metabolism of efavirenz and, therefore, susceptibility to efavirenz toxicity in the central nervous system [MIMi:614546]. Efavirenz is a non-nucleoside reverse transcriptase inhibitor frequently prescribed with 2 nucleoside reverse transcriptase inhibitors as initial therapy for human immunodeficiency virus (HIV) infection. Up to half of patients treated with efavirenz, experience side effects in the central nervous system, including dizziness, insomnia, impaired concentration, somnolence, and abnormal dreams. Severe depression, aggressive behavior, and paranoid or manic reactions may also occur, depending on efavirenz concentration in the plasma.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02356321Q → L in allele CYP2B6*10. 1 PublicationCorresponds to variant rs34883432dbSNPEnsembl.1
Natural variantiVAR_01692722R → C in allele CYP2B6*2 and allele CYP2B6*10. 6 PublicationsCorresponds to variant rs8192709dbSNPEnsembl.1
Natural variantiVAR_02520626T → S.1 PublicationCorresponds to variant rs33973337dbSNPEnsembl.1
Natural variantiVAR_02520728D → G.1 PublicationCorresponds to variant rs33980385dbSNPEnsembl.1
Natural variantiVAR_03381929R → P.Corresponds to variant rs34284776dbSNPEnsembl.1
Natural variantiVAR_02520829R → S.1 PublicationCorresponds to variant rs33926104dbSNPEnsembl.1
Natural variantiVAR_02356446M → V in allele CYP2B6*11. 1 PublicationCorresponds to variant rs35303484dbSNPEnsembl.1
Natural variantiVAR_02356599G → E in allele CYP2B6*12. 1 PublicationCorresponds to variant rs36060847dbSNPEnsembl.1
Natural variantiVAR_016948139K → E in allele CYP2B6*8 and allele CYP2B6*13. 2 PublicationsCorresponds to variant rs12721655dbSNPEnsembl.1
Natural variantiVAR_023566140R → Q in allele CYP2B6*14. 1 PublicationCorresponds to variant rs35773040dbSNPEnsembl.1
Natural variantiVAR_016924167P → A.2 PublicationsCorresponds to variant rs3826711dbSNPEnsembl.1
Natural variantiVAR_016925172Q → H in allele CYP2B6*6, allele CYP2B6*7, allele CYP2B6*9 and allele CYP2B6*13. 8 PublicationsCorresponds to variant rs3745274dbSNPEnsembl.1
Natural variantiVAR_016928259S → R in allele CYP2B6*3. 2 PublicationsCorresponds to variant rs45482602dbSNPEnsembl.1
Natural variantiVAR_016926262K → R in allele CYP2B6*4, allele CYP2B6*6, allele CYP2B6*7 and allele CYP2B6*13; slight decrease in activity. 5 PublicationsCorresponds to variant rs2279343dbSNPEnsembl.1
Natural variantiVAR_025209289N → K.1 PublicationCorresponds to variant rs34277950dbSNPEnsembl.1
Natural variantiVAR_025210306T → S.1 PublicationCorresponds to variant rs34698757dbSNPEnsembl.1
Natural variantiVAR_024716328I → T.2 PublicationsCorresponds to variant rs28399499dbSNPEnsembl.1
Natural variantiVAR_023567391I → N in allele CYP2B6*15. 1 PublicationCorresponds to variant rs35979566dbSNPEnsembl.1
Natural variantiVAR_016929487R → C in allele CYP2B6*5 and allele CYP2B6*7. 6 PublicationsCorresponds to variant rs3211371dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0555711 – 57MELSV…KSFLR → MRCMLTNSHPWCGCDWQ in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_055572162 – 321Missing in isoform 2. 1 PublicationAdd BLAST160

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29874 mRNA. Translation: AAA52144.1.
AF182277 mRNA. Translation: AAF13602.1.
AK301620 mRNA. Translation: BAG63105.1.
DQ298753 Genomic DNA. Translation: ABB84469.1.
AC023172 Genomic DNA. Translation: AAF32444.1.
AC011541 Genomic DNA. No translation available.
X13494 mRNA. No translation available.
CCDSiCCDS12570.1. [P20813-1]
PIRiA32969.
RefSeqiNP_000758.1. NM_000767.4. [P20813-1]
XP_011524852.1. XM_011526550.2. [P20813-2]
UniGeneiHs.1360.

Genome annotation databases

EnsembliENST00000324071; ENSP00000324648; ENSG00000197408. [P20813-1]
GeneIDi1555.
KEGGihsa:1555.
UCSCiuc002opr.2. human. [P20813-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Cytochrome P450 Allele Nomenclature Committee

CYP2B6 alleles

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29874 mRNA. Translation: AAA52144.1.
AF182277 mRNA. Translation: AAF13602.1.
AK301620 mRNA. Translation: BAG63105.1.
DQ298753 Genomic DNA. Translation: ABB84469.1.
AC023172 Genomic DNA. Translation: AAF32444.1.
AC011541 Genomic DNA. No translation available.
X13494 mRNA. No translation available.
CCDSiCCDS12570.1. [P20813-1]
PIRiA32969.
RefSeqiNP_000758.1. NM_000767.4. [P20813-1]
XP_011524852.1. XM_011526550.2. [P20813-2]
UniGeneiHs.1360.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3IBDX-ray2.00A30-491[»]
3QOAX-ray2.10A27-491[»]
3QU8X-ray2.80A/B/C/D/E/F27-491[»]
3UA5X-ray2.80A/B27-491[»]
4I91X-ray2.00A27-491[»]
4RQLX-ray2.10A/B27-491[»]
4RRTX-ray2.20A/B27-491[»]
4ZV8X-ray2.24A30-491[»]
ProteinModelPortaliP20813.
SMRiP20813.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107933. 4 interactors.
STRINGi9606.ENSP00000324648.

Chemistry databases

BindingDBiP20813.
ChEMBLiCHEMBL4729.
DrugBankiDB00321. Amitriptyline.
DB00381. Amlodipine.
DB00701. Amprenavir.
DB01435. Antipyrine.
DB06413. Armodafinil.
DB06697. Artemether.
DB01076. Atorvastatin.
DB00972. Azelastine.
DB00865. Benzphetamine.
DB06770. Benzyl alcohol.
DB04794. Bifonazole.
DB00835. Brompheniramine.
DB01156. Bupropion.
DB00564. Carbamazepine.
DB00748. Carbinoxamine.
DB00169. Cholecalciferol.
DB00568. Cinnarizine.
DB00604. Cisapride.
DB00515. Cisplatin.
DB00215. Citalopram.
DB00349. Clobazam.
DB00636. Clofibrate.
DB00758. Clopidogrel.
DB01559. Clotiazepam.
DB00257. Clotrimazole.
DB01394. Colchicine.
DB00531. Cyclophosphamide.
DB01151. Desipramine.
DB01234. Dexamethasone.
DB00514. Dextromethorphan.
DB00829. Diazepam.
DB00586. Diclofenac.
DB01075. Diphenhydramine.
DB01184. Domperidone.
DB00997. Doxorubicin.
DB00625. Efavirenz.
DB08899. Enzalutamide.
DB00751. Epinastine.
DB00199. Erythromycin.
DB00655. Estrone.
DB00898. Ethanol.
DB01466. Ethylmorphine.
DB04841. Flunarizine.
DB01544. Flunitrazepam.
DB00472. Fluoxetine.
DB01095. Fluvastatin.
DB00176. Fluvoxamine.
DB01320. Fosphenytoin.
DB01159. Halothane.
DB09054. Idelalisib.
DB01181. Ifosfamide.
DB00458. Imipramine.
DB00762. Irinotecan.
DB00753. Isoflurane.
DB01167. Itraconazole.
DB09570. Ixazomib.
DB01221. Ketamine.
DB06738. Ketobemidone.
DB01026. Ketoconazole.
DB00281. Lidocaine.
DB00836. Loperamide.
DB01601. Lopinavir.
DB04871. Lorcaserin.
DB00772. Malathion.
DB01043. Memantine.
DB00333. Methadone.
DB00763. Methimazole.
DB01028. Methoxyflurane.
DB00849. Methylphenobarbital.
DB06710. Methyltestosterone.
DB00379. Mexiletine.
DB06148. Mianserin.
DB01110. Miconazole.
DB00683. Midazolam.
DB00745. Modafinil.
DB00220. Nelfinavir.
DB00238. Nevirapine.
DB00622. Nicardipine.
DB00184. Nicotine.
DB01115. Nifedipine.
DB04868. Nilotinib.
DB00435. Nitric Oxide.
DB09074. Olaparib.
DB01173. Orphenadrine.
DB04938. Ospemifene.
DB00715. Paroxetine.
DB01074. Perhexiline.
DB04930. Permethrin.
DB00850. Perphenazine.
DB00454. Pethidine.
DB01174. Phenobarbital.
DB00252. Phenytoin.
DB06209. Prasugrel.
DB00794. Primidone.
DB01069. Promethazine.
DB00818. Propofol.
DB00908. Quinidine.
DB00481. Raloxifene.
DB08896. Regorafenib.
DB01045. Rifampicin.
DB08864. Rilpivirine.
DB00503. Ritonavir.
DB06176. Romidepsin.
DB00296. Ropivacaine.
DB00778. Roxithromycin.
DB01037. Selegiline.
DB01104. Sertraline.
DB01236. Sevoflurane.
DB00641. Simvastatin.
DB00398. Sorafenib.
DB06729. Sulfaphenazole.
DB01138. Sulfinpyrazone.
DB00675. Tamoxifen.
DB00231. Temazepam.
DB00624. Testosterone.
DB04572. Thiotepa.
DB00208. Ticlopidine.
DB00193. Tramadol.
DB00755. Tretinoin.
DB00313. Valproic Acid.
DB00285. Venlafaxine.
DB00661. Verapamil.
DB09068. Vortioxetine.
GuidetoPHARMACOLOGYi1324.
SwissLipidsiSLP:000001346.

PTM databases

iPTMnetiP20813.
PhosphoSitePlusiP20813.

Polymorphism and mutation databases

BioMutaiCYP2B6.
DMDMi117205.

Proteomic databases

PaxDbiP20813.
PeptideAtlasiP20813.
PRIDEiP20813.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324071; ENSP00000324648; ENSG00000197408. [P20813-1]
GeneIDi1555.
KEGGihsa:1555.
UCSCiuc002opr.2. human. [P20813-1]

Organism-specific databases

CTDi1555.
DisGeNETi1555.
GeneCardsiCYP2B6.
HGNCiHGNC:2615. CYP2B6.
HPAiCAB033866.
HPA048124.
MalaCardsiCYP2B6.
MIMi123930. gene.
614546. phenotype.
neXtProtiNX_P20813.
OpenTargetsiENSG00000197408.
Orphaneti240869. Efavirenz toxicity.
PharmGKBiPA123.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0156. Eukaryota.
COG2124. LUCA.
GeneTreeiENSGT00760000118775.
HOGENOMiHOG000036992.
HOVERGENiHBG015789.
InParanoidiP20813.
KOiK17709.
OMAiYREIEQV.
OrthoDBiEOG091G0BT8.
PhylomeDBiP20813.
TreeFamiTF352043.

Enzyme and pathway databases

BioCyciMetaCyc:HS09587-MONOMER.
ZFISH:HS09587-MONOMER.
BRENDAi1.14.14.1. 2681.
ReactomeiR-HSA-211935. Fatty acids.
R-HSA-211981. Xenobiotics.
R-HSA-211999. CYP2E1 reactions.
SABIO-RKP20813.

Miscellaneous databases

EvolutionaryTraceiP20813.
GeneWikiiCYP2B6.
GenomeRNAii1555.
PROiP20813.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000197408.
CleanExiHS_CYP2B6.
ExpressionAtlasiP20813. baseline and differential.
GenevisibleiP20813. HS.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
IPR008068. Cyt_P450_E_grp-I_CYP2B-like.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
PR01685. EP450ICYP2B.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCP2B6_HUMAN
AccessioniPrimary (citable) accession number: P20813
Secondary accession number(s): B4DWP3, Q2V565, Q9UK46
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 2, 2016
This is version 183 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.