Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-L

Gene

ITGAL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin alpha-L/beta-2 is also a receptor for F11R (PubMed:11812992, PubMed:15528364). Involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes. Contributes to natural killer cell cytotoxicity (PubMed:15356110). Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils (PubMed:11812992). Required for generation of common lymphoid progenitor cells in bone marrow, indicating a role in lymphopoiesis (By similarity). Integrin alpha-L/beta-2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages (PubMed:23775590).By similarity4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi468 – 476Sequence analysis9
Calcium bindingi530 – 538Sequence analysis9
Calcium bindingi590 – 598Sequence analysis9

GO - Molecular functioni

  • cell adhesion molecule binding Source: UniProtKB
  • ICAM-3 receptor activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • cell adhesion Source: UniProtKB
  • cell-matrix adhesion Source: UniProtKB
  • extracellular matrix organization Source: Reactome
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: BHF-UCL
  • inflammatory response Source: UniProtKB
  • integrin-mediated signaling pathway Source: UniProtKB-KW
  • leukocyte cell-cell adhesion Source: BHF-UCL
  • leukocyte migration Source: Reactome
  • movement of cell or subcellular component Source: ProtInc
  • phagocytosis Source: UniProtKB-KW
  • receptor clustering Source: UniProtKB
  • regulation of immune response Source: Reactome
  • signal transduction Source: UniProtKB
  • T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion, Phagocytosis

Keywords - Ligandi

Calcium, Magnesium, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000005844-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-HSA-202733. Cell surface interactions at the vascular wall.
R-HSA-216083. Integrin cell surface interactions.
R-HSA-6798695. Neutrophil degranulation.
SignaLinkiP20701.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-L
Alternative name(s):
CD11 antigen-like family member A
Leukocyte adhesion glycoprotein LFA-1 alpha chain
Short name:
LFA-1A
Leukocyte function-associated molecule 1 alpha chain
CD_antigen: CD11a
Gene namesi
Name:ITGAL
Synonyms:CD11A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:6148. ITGAL.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 1090ExtracellularSequence analysisAdd BLAST1065
Transmembranei1091 – 1111HelicalSequence analysisAdd BLAST21
Topological domaini1112 – 1170CytoplasmicSequence analysisAdd BLAST59

GO - Cellular componenti

  • cell surface Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • integrin alphaL-beta2 complex Source: UniProtKB
  • integrin complex Source: UniProtKB
  • membrane Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1165S → A: Abolishes phosphorylation and MEM-83-activated T-cell adhesion to ICAM1. Abolishes integrin alpha-L/beta-2 activation by CXCL12 and TERF2IP/RAP1. Does not affect heterodimerization of cell surface expression. Does not affect TCR- or phorbol ester-activated T-cell adhesion to ICAM1. 1 Publication1

Organism-specific databases

DisGeNETi3683.
OpenTargetsiENSG00000005844.
PharmGKBiPA29948.

Chemistry databases

ChEMBLiCHEMBL1803.
DrugBankiDB00098. Anti-thymocyte Globulin (Rabbit).
DB00095. Efalizumab.
DB00227. Lovastatin.
GuidetoPHARMACOLOGYi2451.

Polymorphism and mutation databases

BioMutaiITGAL.
DMDMi88911345.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Add BLAST25
ChainiPRO_000001629226 – 1170Integrin alpha-LAdd BLAST1145

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi65N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi73 ↔ 80By similarity
Glycosylationi89N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi111 ↔ 129By similarity
Glycosylationi188N-linked (GlcNAc...)1 Publication1
Glycosylationi649N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi653 ↔ 707By similarity
Glycosylationi670N-linked (GlcNAc...)Sequence analysis1
Glycosylationi726N-linked (GlcNAc...)Sequence analysis1
Glycosylationi730N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi771 ↔ 777By similarity
Disulfide bondi845 ↔ 861By similarity
Glycosylationi862N-linked (GlcNAc...)Sequence analysis1
Glycosylationi885N-linked (GlcNAc...)Sequence analysis1
Glycosylationi897N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi998 ↔ 1013By similarity
Disulfide bondi1021 ↔ 1052By similarity
Glycosylationi1060N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1071N-linked (GlcNAc...)Sequence analysis1
Modified residuei1165Phosphoserine1 Publication1

Post-translational modificationi

In resting T-cells, up to 40% of surface ITGAL is constitutively phosphorylated. Phosphorylation causes conformational changes needed for ligand binding and is necessary for activation by some physiological agents.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP20701.
PaxDbiP20701.
PeptideAtlasiP20701.
PRIDEiP20701.

PTM databases

iPTMnetiP20701.
PhosphoSitePlusiP20701.

Expressioni

Tissue specificityi

Leukocytes.2 Publications

Gene expression databases

BgeeiENSG00000005844.
CleanExiHS_ITGAL.
ExpressionAtlasiP20701. baseline and differential.
GenevisibleiP20701. HS.

Organism-specific databases

HPAiCAB025011.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit (PubMed:12526797). Alpha-L associates with beta-2 (PubMed:12526797). Interacts with THBD (PubMed:27055590).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9WMX22EBI-961214,EBI-6863748From a different organism.
PTPRCP085752EBI-961214,EBI-1341

GO - Molecular functioni

  • cell adhesion molecule binding Source: UniProtKB

Protein-protein interaction databases

BioGridi109889. 6 interactors.
DIPiDIP-623N.
IntActiP20701. 7 interactors.
MINTiMINT-1130696.
STRINGi9606.ENSP00000349252.

Chemistry databases

BindingDBiP20701.

Structurei

Secondary structure

11170
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi30 – 32Combined sources3
Beta strandi34 – 36Combined sources3
Turni43 – 46Combined sources4
Beta strandi47 – 52Combined sources6
Beta strandi55 – 60Combined sources6
Beta strandi69 – 73Combined sources5
Turni75 – 77Combined sources3
Beta strandi80 – 82Combined sources3
Turni93 – 96Combined sources4
Beta strandi97 – 101Combined sources5
Turni103 – 105Combined sources3
Beta strandi108 – 119Combined sources12
Beta strandi122 – 134Combined sources13
Beta strandi140 – 143Combined sources4
Beta strandi155 – 162Combined sources8
Helixi169 – 185Combined sources17
Turni186 – 188Combined sources3
Beta strandi189 – 206Combined sources18
Helixi208 – 214Combined sources7
Helixi217 – 221Combined sources5
Helixi233 – 243Combined sources11
Helixi247 – 249Combined sources3
Beta strandi255 – 265Combined sources11
Helixi274 – 276Combined sources3
Beta strandi279 – 287Combined sources9
Helixi288 – 290Combined sources3
Helixi293 – 297Combined sources5
Helixi298 – 302Combined sources5
Helixi307 – 310Combined sources4
Beta strandi311 – 316Combined sources6
Helixi317 – 319Combined sources3
Helixi323 – 330Combined sources8
Beta strandi331 – 333Combined sources3
Beta strandi352 – 359Combined sources8
Beta strandi362 – 367Combined sources6
Helixi370 – 373Combined sources4
Beta strandi375 – 380Combined sources6
Beta strandi387 – 391Combined sources5
Turni398 – 401Combined sources4
Beta strandi406 – 411Combined sources6
Beta strandi413 – 416Combined sources4
Beta strandi419 – 424Combined sources6
Helixi427 – 429Combined sources3
Beta strandi432 – 437Combined sources6
Beta strandi446 – 452Combined sources7
Beta strandi462 – 467Combined sources6
Beta strandi472 – 474Combined sources3
Beta strandi477 – 482Combined sources6
Beta strandi493 – 499Combined sources7
Beta strandi501 – 510Combined sources10
Beta strandi514 – 516Combined sources3
Beta strandi523 – 527Combined sources5
Beta strandi531 – 535Combined sources5
Beta strandi539 – 543Combined sources5
Beta strandi549 – 554Combined sources6
Beta strandi558 – 561Combined sources4
Beta strandi566 – 570Combined sources5
Helixi571 – 574Combined sources4
Beta strandi583 – 589Combined sources7
Beta strandi593 – 595Combined sources3
Beta strandi598 – 603Combined sources6
Beta strandi606 – 612Combined sources7
Turni1082 – 1086Combined sources5
Helixi1090 – 1114Combined sources25
Helixi1118 – 1123Combined sources6
Turni1124 – 1127Combined sources4
Helixi1137 – 1147Combined sources11
Helixi1153 – 1155Combined sources3
Helixi1156 – 1165Combined sources10
Helixi1167 – 1170Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CQPX-ray2.60A/B153-334[»]
1DGQNMR-A152-336[»]
1IJ4model-L153-333[»]
1LFAX-ray1.80A/B150-336[»]
1MJNX-ray1.30A153-331[»]
1MQ8X-ray3.30B/D155-331[»]
1MQ9X-ray2.00A153-331[»]
1MQAX-ray2.50A153-331[»]
1RD4X-ray2.40A/B/C/D150-336[»]
1T0PX-ray1.66A153-326[»]
1XDDX-ray2.20A/B152-336[»]
1XDGX-ray2.10A/B152-336[»]
1XUOX-ray1.80A/B152-336[»]
1ZONX-ray2.00A150-336[»]
1ZOOX-ray3.00A/B150-336[»]
1ZOPX-ray2.00A/B150-336[»]
2ICAX-ray1.56A154-332[»]
2K8ONMR-A1113-1170[»]
2M3ENMR-A1082-1128[»]
2O7NX-ray1.75A154-332[»]
3BN3X-ray2.10A154-332[»]
3BQMX-ray1.95B/C153-334[»]
3BQNX-ray1.80B/C153-334[»]
3E2MX-ray2.00A/B152-334[»]
3EOAX-ray2.80I/J153-333[»]
3EOBX-ray3.60I/J153-333[»]
3F74X-ray1.70A/B/C153-332[»]
3F78X-ray1.60A/B/C153-332[»]
3HI6X-ray2.30A/B153-332[»]
3M6FX-ray1.85A154-332[»]
3TCXX-ray3.60B/D/F/H/J/L/N/P/R/T/V/X/Z/b154-332[»]
4IXDX-ray1.80A152-336[»]
5E6RX-ray2.90A26-770[»]
5E6SX-ray2.15A/C/E26-770[»]
5E6UX-ray2.50A26-770[»]
ProteinModelPortaliP20701.
SMRiP20701.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP20701.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati31 – 82FG-GAP 1PROSITE-ProRule annotationAdd BLAST52
Repeati83 – 141FG-GAP 2PROSITE-ProRule annotationAdd BLAST59
Domaini156 – 327VWFAPROSITE-ProRule annotationAdd BLAST172
Repeati338 – 389FG-GAP 3PROSITE-ProRule annotationAdd BLAST52
Repeati390 – 445FG-GAP 4PROSITE-ProRule annotationAdd BLAST56
Repeati446 – 506FG-GAP 5PROSITE-ProRule annotationAdd BLAST61
Repeati507 – 563FG-GAP 6PROSITE-ProRule annotationAdd BLAST57
Repeati567 – 627FG-GAP 7PROSITE-ProRule annotationAdd BLAST61

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1115 – 1119GFFKR motif5

Domaini

The integrin I-domain (insert) is a VWFA domain (PubMed:2537322). Integrins with I-domains do not undergo protease cleavage. The I-domain is necessary and sufficient for interaction with ICAM1 and F11R (PubMed:15528364).2 Publications

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated
Contains 7 FG-GAP repeats.PROSITE-ProRule annotation
Contains 1 VWFA domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3637. Eukaryota.
ENOG410XPVZ. LUCA.
GeneTreeiENSGT00760000118782.
HOGENOMiHOG000113114.
HOVERGENiHBG006188.
InParanoidiP20701.
KOiK05718.
OMAiGEDKKCE.
OrthoDBiEOG091G03DW.
PhylomeDBiP20701.
TreeFamiTF105391.

Family and domain databases

InterProiIPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
IPR032695. Integrin_dom.
IPR002035. VWF_A.
[Graphical view]
PfamiPF01839. FG-GAP. 1 hit.
PF00357. Integrin_alpha. 1 hit.
PF08441. Integrin_alpha2. 1 hit.
PF00092. VWA. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF53300. SSF53300. 1 hit.
SSF69179. SSF69179. 2 hits.
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P20701-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKDSCITVMA MALLSGFFFF APASSYNLDV RGARSFSPPR AGRHFGYRVL
60 70 80 90 100
QVGNGVIVGA PGEGNSTGSL YQCQSGTGHC LPVTLRGSNY TSKYLGMTLA
110 120 130 140 150
TDPTDGSILA CDPGLSRTCD QNTYLSGLCY LFRQNLQGPM LQGRPGFQEC
160 170 180 190 200
IKGNVDLVFL FDGSMSLQPD EFQKILDFMK DVMKKLSNTS YQFAAVQFST
210 220 230 240 250
SYKTEFDFSD YVKRKDPDAL LKHVKHMLLL TNTFGAINYV ATEVFREELG
260 270 280 290 300
ARPDATKVLI IITDGEATDS GNIDAAKDII RYIIGIGKHF QTKESQETLH
310 320 330 340 350
KFASKPASEF VKILDTFEKL KDLFTELQKK IYVIEGTSKQ DLTSFNMELS
360 370 380 390 400
SSGISADLSR GHAVVGAVGA KDWAGGFLDL KADLQDDTFI GNEPLTPEVR
410 420 430 440 450
AGYLGYTVTW LPSRQKTSLL ASGAPRYQHM GRVLLFQEPQ GGGHWSQVQT
460 470 480 490 500
IHGTQIGSYF GGELCGVDVD QDGETELLLI GAPLFYGEQR GGRVFIYQRR
510 520 530 540 550
QLGFEEVSEL QGDPGYPLGR FGEAITALTD INGDGLVDVA VGAPLEEQGA
560 570 580 590 600
VYIFNGRHGG LSPQPSQRIE GTQVLSGIQW FGRSIHGVKD LEGDGLADVA
610 620 630 640 650
VGAESQMIVL SSRPVVDMVT LMSFSPAEIP VHEVECSYST SNKMKEGVNI
660 670 680 690 700
TICFQIKSLI PQFQGRLVAN LTYTLQLDGH RTRRRGLFPG GRHELRRNIA
710 720 730 740 750
VTTSMSCTDF SFHFPVCVQD LISPINVSLN FSLWEEEGTP RDQRAQGKDI
760 770 780 790 800
PPILRPSLHS ETWEIPFEKN CGEDKKCEAN LRVSFSPARS RALRLTAFAS
810 820 830 840 850
LSVELSLSNL EEDAYWVQLD LHFPPGLSFR KVEMLKPHSQ IPVSCEELPE
860 870 880 890 900
ESRLLSRALS CNVSSPIFKA GHSVALQMMF NTLVNSSWGD SVELHANVTC
910 920 930 940 950
NNEDSDLLED NSATTIIPIL YPINILIQDQ EDSTLYVSFT PKGPKIHQVK
960 970 980 990 1000
HMYQVRIQPS IHDHNIPTLE AVVGVPQPPS EGPITHQWSV QMEPPVPCHY
1010 1020 1030 1040 1050
EDLERLPDAA EPCLPGALFR CPVVFRQEIL VQVIGTLELV GEIEASSMFS
1060 1070 1080 1090 1100
LCSSLSISFN SSKHFHLYGS NASLAQVVMK VDVVYEKQML YLYVLSGIGG
1110 1120 1130 1140 1150
LLLLLLIFIV LYKVGFFKRN LKEKMEAGRG VPNGIPAEDS EQLASGQEAG
1160 1170
DPGCLKPLHE KDSESGGGKD
Length:1,170
Mass (Da):128,770
Last modified:February 7, 2006 - v3
Checksum:i22A7AF92EF286876
GO
Isoform 2 (identifier: P20701-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     954-954: Q → QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDNIRAGPCR

Note: No experimental confirmation available.
Show »
Length:1,223
Mass (Da):134,427
Checksum:iAF2302FAC076924D
GO
Isoform 3 (identifier: P20701-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-192: Missing.
     746-746: Missing.

Show »
Length:1,086
Mass (Da):119,224
Checksum:iF6FF2546E8C632F9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti660I → Y in CAA68747 (PubMed:2537322).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025235144R → H.1 PublicationCorresponds to variant rs34166708dbSNPEnsembl.1
Natural variantiVAR_025236214R → W.3 PublicationsCorresponds to variant rs1064524dbSNPEnsembl.1
Natural variantiVAR_025237746Q → K.1 PublicationCorresponds to variant rs34838942dbSNPEnsembl.1
Natural variantiVAR_025238791R → T.1 PublicationCorresponds to variant rs2230433dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042842110 – 192Missing in isoform 3. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_042843746Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_002738954Q → QGVHGLVEMQTSKQILCRPA GDAEHTVGAQEGELPCPWGV SEAFRDNIRAGPCR in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y00796 mRNA. Translation: CAA68747.1.
DQ131904 Genomic DNA. Translation: AAZ38713.1.
AC002310 Genomic DNA. Translation: AAC31672.1.
AC116348 Genomic DNA. No translation available.
CH471192 Genomic DNA. Translation: EAW52243.1.
BC008777 mRNA. Translation: AAH08777.1.
M95609 Genomic DNA. Translation: AAA16474.2.
Z22804 Genomic DNA. Translation: CAA80461.1.
M87662 Genomic DNA. No translation available.
CCDSiCCDS32433.1. [P20701-1]
CCDS45461.1. [P20701-3]
PIRiS03308.
RefSeqiNP_001107852.1. NM_001114380.1. [P20701-3]
NP_002200.2. NM_002209.2. [P20701-1]
UniGeneiHs.174103.

Genome annotation databases

EnsembliENST00000356798; ENSP00000349252; ENSG00000005844. [P20701-1]
ENST00000358164; ENSP00000350886; ENSG00000005844. [P20701-3]
GeneIDi3683.
KEGGihsa:3683.
UCSCiuc002dyi.5. human. [P20701-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y00796 mRNA. Translation: CAA68747.1.
DQ131904 Genomic DNA. Translation: AAZ38713.1.
AC002310 Genomic DNA. Translation: AAC31672.1.
AC116348 Genomic DNA. No translation available.
CH471192 Genomic DNA. Translation: EAW52243.1.
BC008777 mRNA. Translation: AAH08777.1.
M95609 Genomic DNA. Translation: AAA16474.2.
Z22804 Genomic DNA. Translation: CAA80461.1.
M87662 Genomic DNA. No translation available.
CCDSiCCDS32433.1. [P20701-1]
CCDS45461.1. [P20701-3]
PIRiS03308.
RefSeqiNP_001107852.1. NM_001114380.1. [P20701-3]
NP_002200.2. NM_002209.2. [P20701-1]
UniGeneiHs.174103.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CQPX-ray2.60A/B153-334[»]
1DGQNMR-A152-336[»]
1IJ4model-L153-333[»]
1LFAX-ray1.80A/B150-336[»]
1MJNX-ray1.30A153-331[»]
1MQ8X-ray3.30B/D155-331[»]
1MQ9X-ray2.00A153-331[»]
1MQAX-ray2.50A153-331[»]
1RD4X-ray2.40A/B/C/D150-336[»]
1T0PX-ray1.66A153-326[»]
1XDDX-ray2.20A/B152-336[»]
1XDGX-ray2.10A/B152-336[»]
1XUOX-ray1.80A/B152-336[»]
1ZONX-ray2.00A150-336[»]
1ZOOX-ray3.00A/B150-336[»]
1ZOPX-ray2.00A/B150-336[»]
2ICAX-ray1.56A154-332[»]
2K8ONMR-A1113-1170[»]
2M3ENMR-A1082-1128[»]
2O7NX-ray1.75A154-332[»]
3BN3X-ray2.10A154-332[»]
3BQMX-ray1.95B/C153-334[»]
3BQNX-ray1.80B/C153-334[»]
3E2MX-ray2.00A/B152-334[»]
3EOAX-ray2.80I/J153-333[»]
3EOBX-ray3.60I/J153-333[»]
3F74X-ray1.70A/B/C153-332[»]
3F78X-ray1.60A/B/C153-332[»]
3HI6X-ray2.30A/B153-332[»]
3M6FX-ray1.85A154-332[»]
3TCXX-ray3.60B/D/F/H/J/L/N/P/R/T/V/X/Z/b154-332[»]
4IXDX-ray1.80A152-336[»]
5E6RX-ray2.90A26-770[»]
5E6SX-ray2.15A/C/E26-770[»]
5E6UX-ray2.50A26-770[»]
ProteinModelPortaliP20701.
SMRiP20701.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109889. 6 interactors.
DIPiDIP-623N.
IntActiP20701. 7 interactors.
MINTiMINT-1130696.
STRINGi9606.ENSP00000349252.

Chemistry databases

BindingDBiP20701.
ChEMBLiCHEMBL1803.
DrugBankiDB00098. Anti-thymocyte Globulin (Rabbit).
DB00095. Efalizumab.
DB00227. Lovastatin.
GuidetoPHARMACOLOGYi2451.

PTM databases

iPTMnetiP20701.
PhosphoSitePlusiP20701.

Polymorphism and mutation databases

BioMutaiITGAL.
DMDMi88911345.

Proteomic databases

MaxQBiP20701.
PaxDbiP20701.
PeptideAtlasiP20701.
PRIDEiP20701.

Protocols and materials databases

DNASUi3683.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356798; ENSP00000349252; ENSG00000005844. [P20701-1]
ENST00000358164; ENSP00000350886; ENSG00000005844. [P20701-3]
GeneIDi3683.
KEGGihsa:3683.
UCSCiuc002dyi.5. human. [P20701-1]

Organism-specific databases

CTDi3683.
DisGeNETi3683.
GeneCardsiITGAL.
H-InvDBHIX0012960.
HIX0026987.
HGNCiHGNC:6148. ITGAL.
HPAiCAB025011.
MIMi153370. gene.
neXtProtiNX_P20701.
OpenTargetsiENSG00000005844.
PharmGKBiPA29948.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3637. Eukaryota.
ENOG410XPVZ. LUCA.
GeneTreeiENSGT00760000118782.
HOGENOMiHOG000113114.
HOVERGENiHBG006188.
InParanoidiP20701.
KOiK05718.
OMAiGEDKKCE.
OrthoDBiEOG091G03DW.
PhylomeDBiP20701.
TreeFamiTF105391.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000005844-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-HSA-202733. Cell surface interactions at the vascular wall.
R-HSA-216083. Integrin cell surface interactions.
R-HSA-6798695. Neutrophil degranulation.
SignaLinkiP20701.

Miscellaneous databases

ChiTaRSiITGAL. human.
EvolutionaryTraceiP20701.
GeneWikiiCD11a.
GenomeRNAii3683.
PROiP20701.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000005844.
CleanExiHS_ITGAL.
ExpressionAtlasiP20701. baseline and differential.
GenevisibleiP20701. HS.

Family and domain databases

InterProiIPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
IPR032695. Integrin_dom.
IPR002035. VWF_A.
[Graphical view]
PfamiPF01839. FG-GAP. 1 hit.
PF00357. Integrin_alpha. 1 hit.
PF08441. Integrin_alpha2. 1 hit.
PF00092. VWA. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
SM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF53300. SSF53300. 1 hit.
SSF69179. SSF69179. 2 hits.
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
PS50234. VWFA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiITAL_HUMAN
AccessioniPrimary (citable) accession number: P20701
Secondary accession number(s): O43746
, Q45H73, Q96HB1, Q9UBC8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 7, 2006
Last modified: November 30, 2016
This is version 186 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.