P20646 (PPAP_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostatic acid phosphatase EC=3.1.3.2 Alternative name(s): 5'-nucleotidase Short name=5'-NT EC=3.1.3.5 Ecto-5'-nucleotidase Fluoride-resistant acid phosphatase Short name=FRAP Thiamine monophosphatase Short name=TMPase | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 381 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma By similarity. Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor. |
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate. |
| Enzyme regulation | Inhibited by L+-tartrate. Ref.4 |
| Subunit structure | Homodimer; dimer formation is required for phosphatase activity. Ref.4 Ref.6 |
| Subcellular location | Isoform 2: Cell membrane; Single-pass type I membrane protein By similarity. Lysosome membrane; Single-pass type I membrane protein By similarity. Note: Appears to shuttle between the cell membrane and intracellular vesicles. Colocalizes with FLOT1 at cell membrane and in intracellular vesicles. Colocalizes with LAMP2 on the lysosome membrane By similarity. |
| Tissue specificity | Expressed in prostate epithelium. Also expressed in the pelvic nerve and sacral spinal cord. Localizes in peptidergic and non-peptidergic nociceptive (pain-sensing) neurons. Ref.3 Ref.5 |
| Post-translational modification | |
| Sequence similarities | Belongs to the histidine acid phosphatase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P20646-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P20646-2) Also known as: TMPase; TM-PAP; cellular PAP; cPAP; The sequence of this isoform differs from the canonical sequence as follows: 379-381: ASL → VLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 32 – 381 | 350 | Prostatic acid phosphatase | PRO_0000023964 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 43 | 1 | Nucleophile Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 289 | 1 | Proton donor Probable | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 42 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 46 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 110 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 288 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 48 | 1 | Important for substrate specificity By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 137 | 1 | Required for dimerization | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 143 | 1 | Required for dimerization | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 205 | 1 | Required for structural stability By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Ref.6 Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 219 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 332 | 1 | N-linked (GlcNAc...) Ref.6 Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 160 ↔ 371 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 214 ↔ 312 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 346 ↔ 350 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 379 – 381 | 3 | ASL → VLRVILATTFCLVTGILVIL LLVLIRHGPCWQRDVYRNI in isoform 2. | VSP_036025 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 137 | 1 | W → E: Abolishes most of enzyme activity and dimer formation. No enzyme activity nor dimer formation; when associated with D-143. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 143 | 1 | H → D: Abolishes most of enzyme activity and dimer formation. No enzyme activity nor dimer formation; when associated with E-137. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 154 | 1 | Y → K: PH optimum at 5.4 as for wild type and no change in specific activity. Lower pH maximum around 4.5 and more sensitive to L(+)tartrate inhibition but no change in specific activity; when associated with G-158. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 158 | 1 | R → G: Broader pH maximum levels around 5.4 but no change in specific activity. Lower pH maximum around 4.5 and more sensitive to L(+)tartrate inhibition but no change in specific activity; when associated with K-154. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 289 | 1 | D → A or S: Abolishes almost all enzyme activity. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 289 | 1 | D → N: Abolishes enzyme activity. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 222 – 223 | 2 | FR → LP in ABH07387. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 288 | 1 | Y → H in ABH07387. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 300 – 301 | 2 | EL → DV in ABH07387. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 324 | 1 | T → H in ABH07387. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 33 – 42 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 61 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 62 – 64 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 71 – 88 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 90 – 92 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 98 – 100 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 105 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 122 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 127 – 129 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 149 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 154 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 161 – 172 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 174 – 180 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 181 – 183 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 184 – 189 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 191 – 194 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 207 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 209 – 216 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 217 – 219 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 228 – 246 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 247 – 250 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 251 – 256 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 272 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 287 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 289 – 299 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 319 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 321 – 331 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 348 – 351 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 359 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 360 – 362 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 367 – 371 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Primary structure of rat secretory acid phosphatase and comparison to other acid phosphatases." Roiko K., Jaenne O.A., Vihko P. Gene 89:223-229(1990) [PubMed: 2373368] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Prostate. |
| [2] | "Prostatic acid phosphatase is not a prostate specific target." Quintero I.B., Araujo C.L., Pulkka A.E., Wirkkala R.S., Herrala A.M., Eskelinen E.-L., Jokitalo E., Hellstroem P.A., Tuominen H.J., Hirvikoski P.P., Vihko P.T. Cancer Res. 67:6549-6554(2007) [PubMed: 17638863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: Sprague-Dawley. |
| [3] | "The localization of fluoride-resistant acid phosphatase (FRAP) in the pelvic nerves and sacral spinal cord of rats." McMahon S.B. Neurosci. Lett. 64:305-310(1986) [PubMed: 2421214] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [4] | "Site-directed mutagenesis of prostatic acid phosphatase. Catalytically important aspartic acid 258, substrate specificity, and oligomerization." Porvari K.S., Herrala A.M., Kurkela R.M., Taavitsainen P.A., Lindqvist Y., Schneider G., Vihko P.T. J. Biol. Chem. 269:22642-22646(1994) [PubMed: 8077215] [Abstract] Cited for: ACTIVE SITE, SUBUNIT, ENZYME REGULATION, SUBSTRATE SPECIFICITY, MUTAGENESIS OF TRP-137; HIS-143; TYR-154; ARG-158 AND ASP-289. |
| [5] | "Prostatic acid phosphatase is expressed in peptidergic and nonpeptidergic nociceptive neurons of mice and rats." Taylor-Blake B., Zylka M.J. PLoS ONE 5:E8674-E8674(2010) [PubMed: 20084276] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [6] | "Three-dimensional structure of rat acid phosphatase." Schneider G., Lindqvist Y., Vihko P. EMBO J. 12:2609-2615(1993) [PubMed: 8334986] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS), SUBUNIT, GLYCOSYLATION AT ASN-93 AND ASN-332. |
| [7] | "Three-dimensional structure of rat acid phosphatase in complex with L(+)-tartrate." Lindqvist Y., Schneider G., Vihko P. J. Biol. Chem. 268:20744-20746(1993) [PubMed: 8407898] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) IN COMPLEX WITH L(+)-TARTRATE, GLYCOSYLATION AT ASN-93 AND ASN-332. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M32397 mRNA. Translation: AAA41806.1. DQ826426 mRNA. Translation: ABH07387.1. | ||||||||||||||||||
| IPI | IPI00201376. IPI00914298. | ||||||||||||||||||
| PIR | JH0152. | ||||||||||||||||||
| RefSeq | NP_001128373.1. NM_001134901.1. NP_064457.1. NM_020072.1. | ||||||||||||||||||
| UniGene | Rn.40121. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P20646. | ||||||||||||||||||
| SMR | P20646. Positions 32-373. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | P20646. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P20646. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSRNOT00000016222; ENSRNOP00000016222; ENSRNOG00000011820. | ||||||||||||||||||
| GeneID | 56780. | ||||||||||||||||||
| KEGG | rno:56780. | ||||||||||||||||||
| UCSC | NM_020072. rat. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 55. | ||||||||||||||||||
| RGD | 2023. Acpp. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | roNOG04279. | ||||||||||||||||||
| HOVERGEN | HBG002203. | ||||||||||||||||||
| InParanoid | P20646. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P20646. | ||||||||||||||||||
| Genevestigator | P20646. | ||||||||||||||||||
| GermOnline | ENSRNOG00000011820. Rattus norvegicus. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000560. His_Pase_superF_clade-2. [Graphical view] | ||||||||||||||||||
| KO | K14410. | ||||||||||||||||||
| Pfam | PF00328. His_Phos_2. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00616. HIS_ACID_PHOSPHAT_1. 1 hit. PS00778. HIS_ACID_PHOSPHAT_2. False negative. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 611179. | ||||||||||||||||||
Entry information
| Entry name | PPAP_RAT | ||||||||
| Accession | Primary (citable) accession number: P20646 Secondary accession number(s): A6XJQ5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with