P20594 (ANPRB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 154.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Atrial natriuretic peptide receptor 2 EC=4.6.1.2 Alternative name(s): Atrial natriuretic peptide receptor type B Short name=ANP-B Short name=ANPR-B Short name=NPR-B Guanylate cyclase B Short name=GC-B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1047 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth. Ref.9 Ref.11 |
| Catalytic activity | GTP = 3',5'-cyclic GMP + diphosphate. |
| Subcellular location | |
| Post-translational modification | Phosphorylation of the protein kinase-like domain is required for full activation by CNP By similarity. |
| Involvement in disease | Acromesomelic dysplasia, Maroteaux type (AMDM) [MIM:602875]: An autosomal recessive acromesomelic chondrodysplasia. Acromesomelic chondrodysplasias are rare hereditary skeletal disorders characterized by short stature, very short limbsand hand/foot malformations. The severity of limb abnormalities increases from proximal to distal with profoundly affected hands and feet showing brachydactyly and/or rudimentary fingers (knob-like fingers). AMDM is characterized by axial skeletal involvement with wedging of vertebral bodies. In AMDM all skeletal elements are present but show abnormal rates of linear growth. |
| Sequence similarities | Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. Contains 1 guanylate cyclase domain. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P20594-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P20594-2) Also known as: NPR-BI; The sequence of this isoform differs from the canonical sequence as follows: 964-1047: PVCAGVVGLK...GERKGPPGLL → KADSHSSPSLHLSQTLPTCFFSKGQSVLGLLA | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||
| Chain | 23 – 1047 | 1025 | Atrial natriuretic peptide receptor 2 | PRO_0000012364 | |||||||
Regions | |||||||||||
| Topological domain | 23 – 458 | 436 | Extracellular Potential | ||||||||
| Transmembrane | 459 – 478 | 20 | Helical; Potential | ||||||||
| Topological domain | 479 – 1047 | 569 | Cytoplasmic Potential | ||||||||
| Domain | 513 – 786 | 274 | Protein kinase | ||||||||
| Domain | 861 – 991 | 131 | Guanylate cyclase | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 513 | 1 | Phosphoserine Ref.12 | ||||||||
| Modified residue | 516 | 1 | Phosphothreonine Ref.12 | ||||||||
| Modified residue | 518 | 1 | Phosphoserine Ref.12 | ||||||||
| Modified residue | 523 | 1 | Phosphoserine Ref.12 | ||||||||
| Modified residue | 526 | 1 | Phosphoserine Ref.12 | ||||||||
| Modified residue | 529 | 1 | Phosphothreonine Ref.12 | ||||||||
| Glycosylation | 24 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 35 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 161 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 195 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 244 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 277 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 349 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 75 ↔ 101 | By similarity | |||||||||
| Disulfide bond | 439 | Interchain Probable | |||||||||
| Disulfide bond | 448 | Interchain Probable | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 964 – 1047 | 84 | PVCAG…PPGLL → KADSHSSPSLHLSQTLPTCF FSKGQSVLGLLA in isoform Short. | VSP_001810 | |||||||
| Natural variant | 32 | 1 | P → T in AMDM. Ref.11 Corresponds to variant rs28931581 [ dbSNP | Ensembl ]. | VAR_022583 | |||||||
| Natural variant | 115 | 1 | W → G in AMDM; markedly deficient activity. Ref.11 Corresponds to variant rs28931582 [ dbSNP | Ensembl ]. | VAR_022584 | |||||||
| Natural variant | 176 | 1 | D → E in AMDM. Ref.11 Corresponds to variant rs28929479 [ dbSNP | Ensembl ]. | VAR_022585 | |||||||
| Natural variant | 232 | 1 | M → I. Ref.13 Corresponds to variant rs55747238 [ dbSNP | Ensembl ]. | VAR_042219 | |||||||
| Natural variant | 297 | 1 | T → M in AMDM; markedly deficient activity. Ref.11 | VAR_022586 | |||||||
| Natural variant | 338 | 1 | Y → C in AMDM. Ref.11 | VAR_022587 | |||||||
| Natural variant | 409 | 1 | A → T in AMDM. Ref.11 | VAR_022588 | |||||||
| Natural variant | 413 | 1 | G → E in AMDM; markedly deficient activity. Ref.11 | VAR_022589 | |||||||
| Natural variant | 708 | 1 | Y → C in AMDM. Ref.11 | VAR_022590 | |||||||
| Natural variant | 771 | 1 | Q → E. Corresponds to variant rs5816 [ dbSNP | Ensembl ]. | VAR_011968 | |||||||
| Natural variant | 776 | 1 | R → W in AMDM. Ref.11 | VAR_022591 | |||||||
| Natural variant | 882 | 1 | V → I. Ref.13 Corresponds to variant rs55700371 [ dbSNP | Ensembl ]. | VAR_042220 | |||||||
| Natural variant | 957 | 1 | R → C in AMDM. Ref.11 | VAR_022592 | |||||||
| Natural variant | 959 | 1 | G → A in AMDM. Ref.11 | VAR_022593 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 755 | 1 | T → S in BAA81737. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Differential activation by atrial and brain natriuretic peptides of two different receptor guanylate cyclases." Chang M.S., Lowe D.G., Lewis M., Hellmiss R., Chen E., Goeddel D.V. Nature 341:68-72(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM LONG). Tissue: Brain. |
| [2] | "Structure of the type B human natriuretic peptide receptor gene and association of a novel microsatellite polymorphism with essential hypertension." Rehemudula D., Nakayama T., Soma M., Takahashi Y., Uwabo J., Sato M., Izumi Y., Kanmatsuse K., Ozawa Y. Circ. Res. 84:605-610(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Blood. |
| [3] | "cGMP-dependent and -independent inhibition of a K+ conductance by natriuretic peptides: molecular and functional studies in human proximal tubule cells." Hirsch J.R., Meyer M., Maegert H.-J., Forssmann W.-G., Mollerup S., Herter P., Weber G., Cermak R., Ankorina-Stark I., Schlatter E., Kruhoffer M. J. Am. Soc. Nephrol. 10:472-480(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Tissue: Kidney. |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG). Tissue: Brain. |
| [8] | "Extracellular domain-IgG fusion proteins for three human natriuretic peptide receptors. Hormone pharmacology and application to solid phase screening of synthetic peptide antisera." Bennett B.D., Bennett G.L., Vitangcol R.V., Jewett J.R., Burnier J., Henzel W., Lowe D.G. J. Biol. Chem. 266:23060-23067(1991) [PubMed] [Europe PMC] [Abstract] Cited for: LIGAND-BINDING. |
| [9] | "Selective activation of the B natriuretic peptide receptor by C-type natriuretic peptide (CNP)." Koller K.J., Lowe D.G., Bennett G.L., Minamino N., Kangawa K., Matsuo H., Goeddel D.V. Science 252:120-123(1991) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [11] | "Mutations in the transmembrane natriuretic peptide receptor NPR-B impair skeletal growth and cause acromesomelic dysplasia, type Maroteaux." Bartels C.F., Buekuelmez H., Padayatti P., Rhee D.K., van Ravenswaaij-Arts C., Pauli R.M., Mundlos S., Chitayat D., Shih L.-Y., Al-Gazali L.I., Kant S., Cole T., Morton J., Cormier-Daire V., Faivre L., Lees M., Kirk J., Mortier G.R. Warman M.L.Am. J. Hum. Genet. 75:27-34(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, VARIANTS AMDM THR-32; GLY-115; GLU-176; MET-297; CYS-338; THR-409; GLU-413; CYS-708; TRP-776; CYS-957 AND ALA-959, CHARACTERIZATION OF VARIANTS AMDM GLY-115; MET-297 AND GLU-413. |
| [12] | "Mass spectrometric identification of phosphorylation sites in guanylyl cyclase A and B." Yoder A.R., Stone M.D., Griffin T.J., Potter L.R. Biochemistry 49:10137-10145(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-513; THR-516; SER-518; SER-523; SER-526 AND THR-529. |
| [13] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-232 AND ILE-882. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB005647 Genomic DNA. Translation: BAA81737.1. AJ005282 mRNA. Translation: CAA06466.1. AL133410 Genomic DNA. Translation: CAI10987.1. EU326311 Genomic DNA. Translation: ACA05920.1. EU326311 Genomic DNA. Translation: ACA05921.1. CH471071 Genomic DNA. Translation: EAW58338.1. CH471071 Genomic DNA. Translation: EAW58337.1. CH471071 Genomic DNA. Translation: EAW58339.1. CH471071 Genomic DNA. Translation: EAW58340.1. BC023017 mRNA. Translation: AAH23017.1. |
| IPI | IPI00024685. IPI00219001. |
| PIR | OYHUBR. S05514. |
| RefSeq | NP_003986.2. NM_003995.3. |
| UniGene | Hs.78518. |
3D structure databases | |
| ProteinModelPortal | P20594. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P20594. 1 interaction. |
| STRING | 9606.ENSP00000341083. |
PTM databases | |
| PhosphoSite | P20594. |
Polymorphism databases | |
| DMDM | 113916. |
Proteomic databases | |
| PaxDb | P20594. |
| PRIDE | P20594. |
Protocols and materials databases | |
| DNASU | 4882. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000342694; ENSP00000341083; ENSG00000159899. |
| GeneID | 4882. |
| KEGG | hsa:4882. |
| UCSC | uc003zyd.3. human. |
Organism-specific databases | |
| CTD | 4882. |
| GeneCards | GC09P035792. |
| H-InvDB | HIX0034787. |
| HGNC | HGNC:7944. NPR2. |
| HPA | HPA011977. |
| MIM | 108961. gene. 602875. phenotype. |
| neXtProt | NX_P20594. |
| Orphanet | 40. Acromesomelic dysplasia, Maroteaux type. |
| PharmGKB | PA257. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG051862. |
| InParanoid | P20594. |
| KO | K12324. |
| OMA | AAKSEHY. |
| OrthoDB | EOG4TF0JG. |
Gene expression databases | |
| ArrayExpress | P20594. |
| Bgee | P20594. |
| CleanEx | HS_NPR2. |
| Genevestigator | P20594. |
| GermOnline | ENSG00000159899. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.70.1230. 1 hit. |
| InterPro | IPR001054. A/G_cyclase. IPR018297. A/G_cyclase_CS. IPR001828. ANF_lig-bd_rcpt. IPR011009. Kinase-like_dom. IPR001170. Ntpep_rcpt. IPR000719. Prot_kinase_cat_dom. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. [Graphical view] |
| Pfam | PF01094. ANF_receptor. 1 hit. PF00211. Guanylate_cyc. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR00255. NATPEPTIDER. |
| SMART | SM00044. CYCc. 1 hit. [Graphical view] |
| SUPFAM | SSF55073. A/G_cyclase. 1 hit. SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00458. ANF_RECEPTORS. 1 hit. PS00452. GUANYLATE_CYCLASE_1. 1 hit. PS50125. GUANYLATE_CYCLASE_2. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P20594. |
| ChEMBL | CHEMBL1795. |
| ChiTaRS | NPR2. human. |
| DrugBank | DB01613. Erythrityl Tetranitrate. DB04899. Nesiritide. |
| GenomeRNAi | 4882. |
| NextBio | 18792. |
| SOURCE | Search... |
Entry information
| Entry name | ANPRB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P20594 Secondary accession number(s): B0ZBF2 Q9UQ50 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
