SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P20594

- ANPRB_HUMAN

UniProt

P20594 - ANPRB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Atrial natriuretic peptide receptor 2
Gene
NPR2, ANPRB
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.2 Publications

Catalytic activityi

GTP = 3',5'-cyclic GMP + diphosphate.

GO - Molecular functioni

  1. ATP binding Source: Ensembl
  2. GTP binding Source: UniProtKB-KW
  3. guanylate cyclase activity Source: UniProtKB
  4. hormone binding Source: UniProtKB
  5. natriuretic peptide receptor activity Source: UniProtKB
  6. peptide hormone binding Source: Ensembl
  7. protein kinase activity Source: InterPro
  8. receptor activity Source: ProtInc
  9. transmembrane signaling receptor activity Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. bone development Source: Ensembl
  2. cGMP biosynthetic process Source: UniProtKB
  3. cell surface receptor signaling pathway Source: ProtInc
  4. cellular response to granulocyte macrophage colony-stimulating factor stimulus Source: UniProtKB
  5. intracellular signal transduction Source: InterPro
  6. ossification Source: UniProtKB-KW
  7. receptor guanylyl cyclase signaling pathway Source: UniProtKB
  8. regulation of blood pressure Source: ProtInc
  9. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Lyase, Receptor

Keywords - Biological processi

cGMP biosynthesis, Osteogenesis

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Atrial natriuretic peptide receptor 2 (EC:4.6.1.2)
Alternative name(s):
Atrial natriuretic peptide receptor type B
Short name:
ANP-B
Short name:
ANPR-B
Short name:
NPR-B
Guanylate cyclase B
Short name:
GC-B
Gene namesi
Name:NPR2
Synonyms:ANPRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:7944. NPR2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini23 – 458436Extracellular Reviewed prediction
Add
BLAST
Transmembranei459 – 47820Helical; Reviewed prediction
Add
BLAST
Topological domaini479 – 1047569Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Acromesomelic dysplasia, Maroteaux type (AMDM) [MIM:602875]: An autosomal recessive acromesomelic chondrodysplasia. Acromesomelic chondrodysplasias are rare hereditary skeletal disorders characterized by short stature, very short limbs and hand/foot malformations. The severity of limb abnormalities increases from proximal to distal with profoundly affected hands and feet showing brachydactyly and/or rudimentary fingers (knob-like fingers). AMDM is characterized by axial skeletal involvement with wedging of vertebral bodies. In AMDM all skeletal elements are present but show abnormal rates of linear growth.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321P → T in AMDM. 1 Publication
Corresponds to variant rs28931581 [ dbSNP | Ensembl ].
VAR_022583
Natural varianti115 – 1151W → G in AMDM; markedly deficient activity. 1 Publication
Corresponds to variant rs28931582 [ dbSNP | Ensembl ].
VAR_022584
Natural varianti176 – 1761D → E in AMDM. 1 Publication
Corresponds to variant rs28929479 [ dbSNP | Ensembl ].
VAR_022585
Natural varianti297 – 2971T → M in AMDM; markedly deficient activity. 1 Publication
VAR_022586
Natural varianti338 – 3381Y → C in AMDM. 1 Publication
VAR_022587
Natural varianti409 – 4091A → T in AMDM. 1 Publication
VAR_022588
Natural varianti413 – 4131G → E in AMDM; markedly deficient activity. 1 Publication
VAR_022589
Natural varianti708 – 7081Y → C in AMDM. 1 Publication
VAR_022590
Natural varianti776 – 7761R → W in AMDM. 1 Publication
VAR_022591
Natural varianti957 – 9571R → C in AMDM. 1 Publication
VAR_022592
Natural varianti959 – 9591G → A in AMDM. 1 Publication
VAR_022593

Keywords - Diseasei

Disease mutation, Dwarfism

Organism-specific databases

MIMi602875. phenotype.
Orphaneti40. Acromesomelic dysplasia, Maroteaux type.
329191. Tall stature - scoliosis - macrodactyly of the great toes.
PharmGKBiPA257.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222 Reviewed prediction
Add
BLAST
Chaini23 – 10471025Atrial natriuretic peptide receptor 2
PRO_0000012364Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi24 – 241N-linked (GlcNAc...) Reviewed prediction
Glycosylationi35 – 351N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi75 ↔ 101 By similarity
Glycosylationi161 – 1611N-linked (GlcNAc...) Reviewed prediction
Glycosylationi195 – 1951N-linked (GlcNAc...) Reviewed prediction
Glycosylationi244 – 2441N-linked (GlcNAc...) Reviewed prediction
Glycosylationi277 – 2771N-linked (GlcNAc...) Reviewed prediction
Glycosylationi349 – 3491N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi439 – 439Interchain Inferred
Disulfide bondi448 – 448Interchain Inferred
Modified residuei513 – 5131Phosphoserine1 Publication
Modified residuei516 – 5161Phosphothreonine1 Publication
Modified residuei518 – 5181Phosphoserine1 Publication
Modified residuei523 – 5231Phosphoserine1 Publication
Modified residuei526 – 5261Phosphoserine1 Publication
Modified residuei529 – 5291Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylation of the protein kinase-like domain is required for full activation by CNP By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP20594.
PaxDbiP20594.
PRIDEiP20594.

PTM databases

PhosphoSiteiP20594.

Expressioni

Gene expression databases

ArrayExpressiP20594.
BgeeiP20594.
CleanExiHS_NPR2.
GenevestigatoriP20594.

Organism-specific databases

HPAiHPA011977.

Interactioni

Protein-protein interaction databases

BioGridi110942. 4 interactions.
IntActiP20594. 1 interaction.
STRINGi9606.ENSP00000341083.

Structurei

3D structure databases

ProteinModelPortaliP20594.
SMRiP20594. Positions 24-442, 503-832, 854-1036.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini513 – 786274Protein kinase
Add
BLAST
Domaini861 – 991131Guanylate cyclase
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG051862.
InParanoidiP20594.
KOiK12324.
OMAiAAKSEHY.
OrthoDBiEOG7Z69BJ.
PhylomeDBiP20594.
TreeFamiTF106338.

Family and domain databases

Gene3Di3.30.70.1230. 1 hit.
InterProiIPR001054. A/G_cyclase.
IPR018297. A/G_cyclase_CS.
IPR001828. ANF_lig-bd_rcpt.
IPR011009. Kinase-like_dom.
IPR001170. Ntpep_rcpt.
IPR028082. Peripla_BP_I.
IPR000719. Prot_kinase_dom.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
[Graphical view]
PfamiPF01094. ANF_receptor. 1 hit.
PF00211. Guanylate_cyc. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR00255. NATPEPTIDER.
SMARTiSM00044. CYCc. 1 hit.
[Graphical view]
SUPFAMiSSF53822. SSF53822. 1 hit.
SSF55073. SSF55073. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00458. ANF_RECEPTORS. 1 hit.
PS00452. GUANYLATE_CYCLASE_1. 1 hit.
PS50125. GUANYLATE_CYCLASE_2. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: P20594-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALPSLLLLV AALAGGVRPP GARNLTLAVV LPEHNLSYAW AWPRVGPAVA     50
LAVEALGRAL PVDLRFVSSE LEGACSEYLA PLSAVDLKLY HDPDLLLGPG 100
CVYPAASVAR FASHWRLPLL TAGAVASGFS AKNDHYRTLV RTGPSAPKLG 150
EFVVTLHGHF NWTARAALLY LDARTDDRPH YFTIEGVFEA LQGSNLSVQH 200
QVYAREPGGP EQATHFIRAN GRIVYICGPL EMLHEILLQA QRENLTNGDY 250
VFFYLDVFGE SLRAGPTRAT GRPWQDNRTR EQAQALREAF QTVLVITYRE 300
PPNPEYQEFQ NRLLIRARED FGVELGPSLM NLIAGCFYDG ILLYAEVLNE 350
TIQEGGTRED GLRIVEKMQG RRYHGVTGLV VMDKNNDRET DFVLWAMGDL 400
DSGDFQPAAH YSGAEKQIWW TGRPIPWVKG APPSDNPPCA FDLDDPSCDK 450
TPLSTLAIVA LGTGITFIMF GVSSFLIFRK LMLEKELASM LWRIRWEELQ 500
FGNSERYHKG AGSRLTLSLR GSSYGSLMTA HGKYQIFANT GHFKGNVVAI 550
KHVNKKRIEL TRQVLFELKH MRDVQFNHLT RFIGACIDPP NICIVTEYCP 600
RGSLQDILEN DSINLDWMFR YSLINDLVKG MAFLHNSIIS SHGSLKSSNC 650
VVDSRFVLKI TDYGLASFRS TAEPDDSHAL YAKKLWTAPE LLSGNPLPTT 700
GMQKADVYSF GIILQEIALR SGPFYLEGLD LSPKEIVQKV RNGQRPYFRP 750
SIDRTQLNEE LVLLMERCWA QDPAERPDFG QIKGFIRRFN KEGGTSILDN 800
LLLRMEQYAN NLEKLVEERT QAYLEEKRKA EALLYQILPH SVAEQLKRGE 850
TVQAEAFDSV TIYFSDIVGF TALSAESTPM QVVTLLNDLY TCFDAIIDNF 900
DVYKVETIGD AYMVVSGLPG RNGQRHAPEI ARMALALLDA VSSFRIRHRP 950
HDQLRLRIGV HTGPVCAGVV GLKMPRYCLF GDTVNTASRM ESNGQALKIH 1000
VSSTTKDALD ELGCFQLELR GDVEMKGKGK MRTYWLLGER KGPPGLL 1047
Length:1,047
Mass (Da):117,022
Last modified:February 1, 1991 - v1
Checksum:i817FB74D6B31F7EF
GO
Isoform Short (identifier: P20594-2) [UniParc]FASTAAdd to Basket

Also known as: NPR-BI

The sequence of this isoform differs from the canonical sequence as follows:
     964-1047: PVCAGVVGLK...GERKGPPGLL → KADSHSSPSLHLSQTLPTCFFSKGQSVLGLLA

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:995
Mass (Da):111,208
Checksum:i745D41E451E0D7DF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321P → T in AMDM. 1 Publication
Corresponds to variant rs28931581 [ dbSNP | Ensembl ].
VAR_022583
Natural varianti115 – 1151W → G in AMDM; markedly deficient activity. 1 Publication
Corresponds to variant rs28931582 [ dbSNP | Ensembl ].
VAR_022584
Natural varianti176 – 1761D → E in AMDM. 1 Publication
Corresponds to variant rs28929479 [ dbSNP | Ensembl ].
VAR_022585
Natural varianti232 – 2321M → I.1 Publication
Corresponds to variant rs55747238 [ dbSNP | Ensembl ].
VAR_042219
Natural varianti297 – 2971T → M in AMDM; markedly deficient activity. 1 Publication
VAR_022586
Natural varianti338 – 3381Y → C in AMDM. 1 Publication
VAR_022587
Natural varianti409 – 4091A → T in AMDM. 1 Publication
VAR_022588
Natural varianti413 – 4131G → E in AMDM; markedly deficient activity. 1 Publication
VAR_022589
Natural varianti708 – 7081Y → C in AMDM. 1 Publication
VAR_022590
Natural varianti771 – 7711Q → E.
Corresponds to variant rs5816 [ dbSNP | Ensembl ].
VAR_011968
Natural varianti776 – 7761R → W in AMDM. 1 Publication
VAR_022591
Natural varianti882 – 8821V → I.1 Publication
Corresponds to variant rs55700371 [ dbSNP | Ensembl ].
VAR_042220
Natural varianti957 – 9571R → C in AMDM. 1 Publication
VAR_022592
Natural varianti959 – 9591G → A in AMDM. 1 Publication
VAR_022593

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei964 – 104784PVCAG…PPGLL → KADSHSSPSLHLSQTLPTCF FSKGQSVLGLLA in isoform Short.
VSP_001810Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti755 – 7551T → S in BAA81737. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB005647 Genomic DNA. Translation: BAA81737.1.
AJ005282 mRNA. Translation: CAA06466.1.
AL133410 Genomic DNA. Translation: CAI10987.1.
EU326311 Genomic DNA. Translation: ACA05920.1.
EU326311 Genomic DNA. Translation: ACA05921.1.
CH471071 Genomic DNA. Translation: EAW58338.1.
CH471071 Genomic DNA. Translation: EAW58337.1.
CH471071 Genomic DNA. Translation: EAW58339.1.
CH471071 Genomic DNA. Translation: EAW58340.1.
BC023017 mRNA. Translation: AAH23017.1.
CCDSiCCDS6590.1. [P20594-1]
PIRiS05514. OYHUBR.
RefSeqiNP_003986.2. NM_003995.3. [P20594-1]
UniGeneiHs.78518.

Genome annotation databases

EnsembliENST00000342694; ENSP00000341083; ENSG00000159899. [P20594-1]
GeneIDi4882.
KEGGihsa:4882.
UCSCiuc003zyd.3. human. [P20594-1]

Polymorphism databases

DMDMi113916.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB005647 Genomic DNA. Translation: BAA81737.1 .
AJ005282 mRNA. Translation: CAA06466.1 .
AL133410 Genomic DNA. Translation: CAI10987.1 .
EU326311 Genomic DNA. Translation: ACA05920.1 .
EU326311 Genomic DNA. Translation: ACA05921.1 .
CH471071 Genomic DNA. Translation: EAW58338.1 .
CH471071 Genomic DNA. Translation: EAW58337.1 .
CH471071 Genomic DNA. Translation: EAW58339.1 .
CH471071 Genomic DNA. Translation: EAW58340.1 .
BC023017 mRNA. Translation: AAH23017.1 .
CCDSi CCDS6590.1. [P20594-1 ]
PIRi S05514. OYHUBR.
RefSeqi NP_003986.2. NM_003995.3. [P20594-1 ]
UniGenei Hs.78518.

3D structure databases

ProteinModelPortali P20594.
SMRi P20594. Positions 24-442, 503-832, 854-1036.
ModBasei Search...

Protein-protein interaction databases

BioGridi 110942. 4 interactions.
IntActi P20594. 1 interaction.
STRINGi 9606.ENSP00000341083.

Chemistry

BindingDBi P20594.
ChEMBLi CHEMBL2111337.
DrugBanki DB01613. Erythrityl Tetranitrate.
DB04899. Nesiritide.
GuidetoPHARMACOLOGYi 1748.

PTM databases

PhosphoSitei P20594.

Polymorphism databases

DMDMi 113916.

Proteomic databases

MaxQBi P20594.
PaxDbi P20594.
PRIDEi P20594.

Protocols and materials databases

DNASUi 4882.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000342694 ; ENSP00000341083 ; ENSG00000159899 . [P20594-1 ]
GeneIDi 4882.
KEGGi hsa:4882.
UCSCi uc003zyd.3. human. [P20594-1 ]

Organism-specific databases

CTDi 4882.
GeneCardsi GC09P035792.
H-InvDB HIX0034787.
HGNCi HGNC:7944. NPR2.
HPAi HPA011977.
MIMi 108961. gene.
602875. phenotype.
neXtProti NX_P20594.
Orphaneti 40. Acromesomelic dysplasia, Maroteaux type.
329191. Tall stature - scoliosis - macrodactyly of the great toes.
PharmGKBi PA257.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG051862.
InParanoidi P20594.
KOi K12324.
OMAi AAKSEHY.
OrthoDBi EOG7Z69BJ.
PhylomeDBi P20594.
TreeFami TF106338.

Miscellaneous databases

ChiTaRSi NPR2. human.
GeneWikii NPR2.
GenomeRNAii 4882.
NextBioi 18792.
PROi P20594.
SOURCEi Search...

Gene expression databases

ArrayExpressi P20594.
Bgeei P20594.
CleanExi HS_NPR2.
Genevestigatori P20594.

Family and domain databases

Gene3Di 3.30.70.1230. 1 hit.
InterProi IPR001054. A/G_cyclase.
IPR018297. A/G_cyclase_CS.
IPR001828. ANF_lig-bd_rcpt.
IPR011009. Kinase-like_dom.
IPR001170. Ntpep_rcpt.
IPR028082. Peripla_BP_I.
IPR000719. Prot_kinase_dom.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
[Graphical view ]
Pfami PF01094. ANF_receptor. 1 hit.
PF00211. Guanylate_cyc. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR00255. NATPEPTIDER.
SMARTi SM00044. CYCc. 1 hit.
[Graphical view ]
SUPFAMi SSF53822. SSF53822. 1 hit.
SSF55073. SSF55073. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEi PS00458. ANF_RECEPTORS. 1 hit.
PS00452. GUANYLATE_CYCLASE_1. 1 hit.
PS50125. GUANYLATE_CYCLASE_2. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Differential activation by atrial and brain natriuretic peptides of two different receptor guanylate cyclases."
    Chang M.S., Lowe D.G., Lewis M., Hellmiss R., Chen E., Goeddel D.V.
    Nature 341:68-72(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM LONG).
    Tissue: Brain.
  2. "Structure of the type B human natriuretic peptide receptor gene and association of a novel microsatellite polymorphism with essential hypertension."
    Rehemudula D., Nakayama T., Soma M., Takahashi Y., Uwabo J., Sato M., Izumi Y., Kanmatsuse K., Ozawa Y.
    Circ. Res. 84:605-610(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Blood.
  3. "cGMP-dependent and -independent inhibition of a K+ conductance by natriuretic peptides: molecular and functional studies in human proximal tubule cells."
    Hirsch J.R., Meyer M., Maegert H.-J., Forssmann W.-G., Mollerup S., Herter P., Weber G., Cermak R., Ankorina-Stark I., Schlatter E., Kruhoffer M.
    J. Am. Soc. Nephrol. 10:472-480(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
    Tissue: Kidney.
  4. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. NHLBI resequencing and genotyping service (RS&G)
    Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
    Tissue: Brain.
  8. "Extracellular domain-IgG fusion proteins for three human natriuretic peptide receptors. Hormone pharmacology and application to solid phase screening of synthetic peptide antisera."
    Bennett B.D., Bennett G.L., Vitangcol R.V., Jewett J.R., Burnier J., Henzel W., Lowe D.G.
    J. Biol. Chem. 266:23060-23067(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: LIGAND-BINDING.
  9. "Selective activation of the B natriuretic peptide receptor by C-type natriuretic peptide (CNP)."
    Koller K.J., Lowe D.G., Bennett G.L., Minamino N., Kangawa K., Matsuo H., Goeddel D.V.
    Science 252:120-123(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  11. Cited for: FUNCTION, VARIANTS AMDM THR-32; GLY-115; GLU-176; MET-297; CYS-338; THR-409; GLU-413; CYS-708; TRP-776; CYS-957 AND ALA-959, CHARACTERIZATION OF VARIANTS AMDM GLY-115; MET-297 AND GLU-413.
  12. "Mass spectrometric identification of phosphorylation sites in guanylyl cyclase A and B."
    Yoder A.R., Stone M.D., Griffin T.J., Potter L.R.
    Biochemistry 49:10137-10145(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-513; THR-516; SER-518; SER-523; SER-526 AND THR-529.
  13. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] ILE-232 AND ILE-882.

Entry informationi

Entry nameiANPRB_HUMAN
AccessioniPrimary (citable) accession number: P20594
Secondary accession number(s): B0ZBF2
, B0ZBF3, D3DRP3, D3DRP4, O60871, Q4VAK7, Q5TCV2, Q8TA93, Q9UQ50
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: July 9, 2014
This is version 167 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi