Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P20151

- KLK2_HUMAN

UniProt

P20151 - KLK2_HUMAN

Protein

Kallikrein-2

Gene

KLK2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 1 (01 Feb 1991)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

    Catalytic activityi

    Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei65 – 651Charge relay system
    Active sitei120 – 1201Charge relay system
    Active sitei213 – 2131Charge relay system

    GO - Molecular functioni

    1. serine-type endopeptidase activity Source: BHF-UCL

    GO - Biological processi

    1. extracellular matrix disassembly Source: Reactome
    2. extracellular matrix organization Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Protease, Serine protease

    Enzyme and pathway databases

    ReactomeiREACT_118682. Activation of Matrix Metalloproteinases.
    REACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

    Protein family/group databases

    MEROPSiS01.161.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kallikrein-2 (EC:3.4.21.35)
    Alternative name(s):
    Glandular kallikrein-1
    Short name:
    hGK-1
    Tissue kallikrein-2
    Gene namesi
    Name:KLK2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:6363. KLK2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: Reactome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30152.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818CuratedAdd
    BLAST
    Propeptidei19 – 246Activation peptideCuratedPRO_0000027929
    Chaini25 – 261237Kallikrein-2PRO_0000027930Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi31 ↔ 173PROSITE-ProRule annotation
    Disulfide bondi50 ↔ 66PROSITE-ProRule annotation
    Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi152 ↔ 219PROSITE-ProRule annotation
    Disulfide bondi184 ↔ 198PROSITE-ProRule annotation
    Disulfide bondi209 ↔ 234PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Zymogen

    Proteomic databases

    MaxQBiP20151.
    PaxDbiP20151.
    PRIDEiP20151.

    PTM databases

    PhosphoSiteiP20151.

    Miscellaneous databases

    PMAP-CutDBP20151.

    Expressioni

    Gene expression databases

    ArrayExpressiP20151.
    BgeeiP20151.
    CleanExiHS_KLK2.
    GenevestigatoriP20151.

    Organism-specific databases

    HPAiHPA000764.

    Interactioni

    Protein-protein interaction databases

    BioGridi110017. 7 interactions.
    STRINGi9606.ENSP00000313581.

    Structurei

    3D structure databases

    ProteinModelPortaliP20151.
    SMRiP20151. Positions 25-261.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini25 – 258234Peptidase S1PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation
    Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG5640.
    HOGENOMiHOG000251820.
    HOVERGENiHBG013304.
    InParanoidiP20151.
    KOiK01325.
    OMAiVHYQKWI.
    PhylomeDBiP20151.
    TreeFamiTF331065.

    Family and domain databases

    InterProiIPR001254. Peptidase_S1.
    IPR018114. Peptidase_S1_AS.
    IPR001314. Peptidase_S1A.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view]
    PfamiPF00089. Trypsin. 1 hit.
    [Graphical view]
    PRINTSiPR00722. CHYMOTRYPSIN.
    SMARTiSM00020. Tryp_SPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF50494. SSF50494. 1 hit.
    PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
    PS00134. TRYPSIN_HIS. 1 hit.
    PS00135. TRYPSIN_SER. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P20151-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWDLVLSIAL SVGCTGAVPL IQSRIVGGWE CEKHSQPWQV AVYSHGWAHC    50
    GGVLVHPQWV LTAAHCLKKN SQVWLGRHNL FEPEDTGQRV PVSHSFPHPL 100
    YNMSLLKHQS LRPDEDSSHD LMLLRLSEPA KITDVVKVLG LPTQEPALGT 150
    TCYASGWGSI EPEEFLRPRS LQCVSLHLLS NDMCARAYSE KVTEFMLCAG 200
    LWTGGKDTCG GDSGGPLVCN GVLQGITSWG PEPCALPEKP AVYTKVVHYR 250
    KWIKDTIAAN P 261
    Length:261
    Mass (Da):28,671
    Last modified:February 1, 1991 - v1
    Checksum:i9CF7F4A1162EF42D
    GO
    Isoform 2 (identifier: P20151-2) [UniParc]FASTAAdd to Basket

    Also known as: PGK-10A

    The sequence of this isoform differs from the canonical sequence as follows:
         211-261: GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP → VSHPYSQHLEGKG

    Show »
    Length:223
    Mass (Da):24,674
    Checksum:i051F76900C2AFEA9
    GO
    Isoform 3 (identifier: P20151-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         165-261: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:164
    Mass (Da):18,162
    Checksum:i00D2AE5561DB788E
    GO
    Isoform 4 (identifier: P20151-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-102: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:159
    Mass (Da):17,301
    Checksum:iB978EFD702D36903
    GO

    Sequence cautioni

    The sequence AAD13817.1 differs from that shown. Reason:

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti143 – 1431T → A in BAG62255. (PubMed:14702039)Curated
    Isoform 2 (identifier: P20151-2)
    Sequence conflicti223 – 2231G → GE in BAG62272. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti18 – 181V → L.1 Publication
    Corresponds to variant rs6072 [ dbSNP | Ensembl ].
    VAR_014164
    Natural varianti250 – 2501R → W.
    Corresponds to variant rs198977 [ dbSNP | Ensembl ].
    VAR_020178
    Natural varianti255 – 2551D → A.
    Corresponds to variant rs60268688 [ dbSNP | Ensembl ].
    VAR_061775

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 102102Missing in isoform 4. 1 PublicationVSP_044709Add
    BLAST
    Alternative sequencei165 – 26197Missing in isoform 3. CuratedVSP_005400Add
    BLAST
    Alternative sequencei211 – 26151GDSGG…IAANP → VSHPYSQHLEGKG in isoform 2. 2 PublicationsVSP_005399Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M18156 Genomic DNA. No translation available.
    M18157 Genomic DNA. Translation: AAA74454.1.
    S39329 mRNA. Translation: AAD13816.1.
    S39329 mRNA. Translation: AAD13817.1. Sequence problems.
    AF188745 mRNA. Translation: AAF08275.1.
    AF188746 mRNA. Translation: AAF08276.1.
    AF188747 mRNA. Translation: AAF08277.1.
    AF243527 Genomic DNA. Translation: AAG33356.1.
    BT006650 mRNA. Translation: AAP35296.1.
    AK300549 mRNA. Translation: BAG62255.1.
    AK300566 mRNA. Translation: BAG62272.1.
    AC037199 Genomic DNA. No translation available.
    BC005196 mRNA. Translation: AAH05196.1.
    CCDSiCCDS12808.1. [P20151-1]
    CCDS42597.1. [P20151-2]
    CCDS58675.1. [P20151-4]
    PIRiA29586.
    RefSeqiNP_001002231.1. NM_001002231.2. [P20151-2]
    NP_001243009.1. NM_001256080.1. [P20151-4]
    NP_005542.1. NM_005551.4. [P20151-1]
    XP_006723272.1. XM_006723209.1. [P20151-3]
    UniGeneiHs.515560.

    Genome annotation databases

    GeneIDi3817.
    KEGGihsa:3817.
    UCSCiuc002ptu.3. human. [P20151-2]
    uc002ptv.3. human. [P20151-1]

    Polymorphism databases

    DMDMi125174.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M18156 Genomic DNA. No translation available.
    M18157 Genomic DNA. Translation: AAA74454.1 .
    S39329 mRNA. Translation: AAD13816.1 .
    S39329 mRNA. Translation: AAD13817.1 . Sequence problems.
    AF188745 mRNA. Translation: AAF08275.1 .
    AF188746 mRNA. Translation: AAF08276.1 .
    AF188747 mRNA. Translation: AAF08277.1 .
    AF243527 Genomic DNA. Translation: AAG33356.1 .
    BT006650 mRNA. Translation: AAP35296.1 .
    AK300549 mRNA. Translation: BAG62255.1 .
    AK300566 mRNA. Translation: BAG62272.1 .
    AC037199 Genomic DNA. No translation available.
    BC005196 mRNA. Translation: AAH05196.1 .
    CCDSi CCDS12808.1. [P20151-1 ]
    CCDS42597.1. [P20151-2 ]
    CCDS58675.1. [P20151-4 ]
    PIRi A29586.
    RefSeqi NP_001002231.1. NM_001002231.2. [P20151-2 ]
    NP_001243009.1. NM_001256080.1. [P20151-4 ]
    NP_005542.1. NM_005551.4. [P20151-1 ]
    XP_006723272.1. XM_006723209.1. [P20151-3 ]
    UniGenei Hs.515560.

    3D structure databases

    ProteinModelPortali P20151.
    SMRi P20151. Positions 25-261.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110017. 7 interactions.
    STRINGi 9606.ENSP00000313581.

    Chemistry

    BindingDBi P20151.
    ChEMBLi CHEMBL2442.

    Protein family/group databases

    MEROPSi S01.161.

    PTM databases

    PhosphoSitei P20151.

    Polymorphism databases

    DMDMi 125174.

    Proteomic databases

    MaxQBi P20151.
    PaxDbi P20151.
    PRIDEi P20151.

    Protocols and materials databases

    DNASUi 3817.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 3817.
    KEGGi hsa:3817.
    UCSCi uc002ptu.3. human. [P20151-2 ]
    uc002ptv.3. human. [P20151-1 ]

    Organism-specific databases

    CTDi 3817.
    GeneCardsi GC19P051376.
    HGNCi HGNC:6363. KLK2.
    HPAi HPA000764.
    MIMi 147960. gene.
    neXtProti NX_P20151.
    PharmGKBi PA30152.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5640.
    HOGENOMi HOG000251820.
    HOVERGENi HBG013304.
    InParanoidi P20151.
    KOi K01325.
    OMAi VHYQKWI.
    PhylomeDBi P20151.
    TreeFami TF331065.

    Enzyme and pathway databases

    Reactomei REACT_118682. Activation of Matrix Metalloproteinases.
    REACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

    Miscellaneous databases

    ChiTaRSi KLK2. human.
    GenomeRNAii 3817.
    NextBioi 15005.
    PMAP-CutDB P20151.
    PROi P20151.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P20151.
    Bgeei P20151.
    CleanExi HS_KLK2.
    Genevestigatori P20151.

    Family and domain databases

    InterProi IPR001254. Peptidase_S1.
    IPR018114. Peptidase_S1_AS.
    IPR001314. Peptidase_S1A.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view ]
    Pfami PF00089. Trypsin. 1 hit.
    [Graphical view ]
    PRINTSi PR00722. CHYMOTRYPSIN.
    SMARTi SM00020. Tryp_SPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50494. SSF50494. 1 hit.
    PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
    PS00134. TRYPSIN_HIS. 1 hit.
    PS00135. TRYPSIN_SER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Primary structure of a human glandular kallikrein gene."
      Schedlich L.J., Bennetts B.H., Morris B.J.
      DNA 6:429-437(1987) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    2. "Identification and androgen-regulated expression of two major human glandular kallikrein-1 (hGK-1) mRNA species."
      Riegman P.H., Vlietstra R.J., der Korput H.A., Romijn J.C., Trapman J.
      Mol. Cell. Endocrinol. 76:181-190(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Prostate.
    3. "Identification of three new alternate human kallikrein 2 transcripts: evidence of long transcript and alternative splicing."
      Liu X.F., Essand M., Vasmatzis G., Lee B., Pastan I.
      Biochem. Biophys. Res. Commun. 264:833-839(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    4. "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
      Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
      Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: Prostate.
    7. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Prostate.
    9. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
    10. Cited for: VARIANT LEU-18.

    Entry informationi

    Entry nameiKLK2_HUMAN
    AccessioniPrimary (citable) accession number: P20151
    Secondary accession number(s): B4DU93
    , B4DUB0, F5H8L3, Q15946, Q9UJZ9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1991
    Last sequence update: February 1, 1991
    Last modified: October 1, 2014
    This is version 150 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Peptidase families
      Classification of peptidase families and list of entries
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3