Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P20151 (KLK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 144. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kallikrein-2

EC=3.4.21.35
Alternative name(s):
Glandular kallikrein-1
Short name=hGK-1
Tissue kallikrein-2
Gene names
Name:KLK2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length261 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Catalytic activity

Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.

Sequence similarities

Belongs to the peptidase S1 family. Kallikrein subfamily.

Contains 1 peptidase S1 domain.

Sequence caution

The sequence AAD13817.1 differs from that shown. Reason:

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   Molecular functionHydrolase
Protease
Serine protease
   PTMDisulfide bond
Glycoprotein
Zymogen
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processextracellular matrix disassembly

Traceable author statement. Source: Reactome

proteolysis

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentextracellular region

Traceable author statement. Source: Reactome

   Molecular_functionserine-type endopeptidase activity

Inferred from direct assay PubMed 9042371. Source: BHF-UCL

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P20151-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P20151-2)

Also known as: PGK-10A;

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP → VSHPYSQHLEGKG
Isoform 3 (identifier: P20151-3)

The sequence of this isoform differs from the canonical sequence as follows:
     165-261: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: P20151-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1818 Probable
Propeptide19 – 246Activation peptide Probable
PRO_0000027929
Chain25 – 261237Kallikrein-2
PRO_0000027930

Regions

Domain25 – 258234Peptidase S1

Sites

Active site651Charge relay system
Active site1201Charge relay system
Active site2131Charge relay system

Amino acid modifications

Glycosylation1021N-linked (GlcNAc...) Potential
Disulfide bond31 ↔ 173 By similarity
Disulfide bond50 ↔ 66 By similarity
Disulfide bond152 ↔ 219 By similarity
Disulfide bond184 ↔ 198 By similarity
Disulfide bond209 ↔ 234 By similarity

Natural variations

Alternative sequence1 – 102102Missing in isoform 4.
VSP_044709
Alternative sequence165 – 26197Missing in isoform 3.
VSP_005400
Alternative sequence211 – 26151GDSGG…IAANP → VSHPYSQHLEGKG in isoform 2.
VSP_005399
Natural variant181V → L. Ref.10
Corresponds to variant rs6072 [ dbSNP | Ensembl ].
VAR_014164
Natural variant2501R → W.
Corresponds to variant rs198977 [ dbSNP | Ensembl ].
VAR_020178
Natural variant2551D → A.
Corresponds to variant rs60268688 [ dbSNP | Ensembl ].
VAR_061775

Experimental info

Sequence conflict1431T → A in BAG62255. Ref.6
Isoform 2:
Sequence conflict2231G → GE in BAG62272. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1991. Version 1.
Checksum: 9CF7F4A1162EF42D

FASTA26128,671
        10         20         30         40         50         60 
MWDLVLSIAL SVGCTGAVPL IQSRIVGGWE CEKHSQPWQV AVYSHGWAHC GGVLVHPQWV 

        70         80         90        100        110        120 
LTAAHCLKKN SQVWLGRHNL FEPEDTGQRV PVSHSFPHPL YNMSLLKHQS LRPDEDSSHD 

       130        140        150        160        170        180 
LMLLRLSEPA KITDVVKVLG LPTQEPALGT TCYASGWGSI EPEEFLRPRS LQCVSLHLLS 

       190        200        210        220        230        240 
NDMCARAYSE KVTEFMLCAG LWTGGKDTCG GDSGGPLVCN GVLQGITSWG PEPCALPEKP 

       250        260 
AVYTKVVHYR KWIKDTIAAN P 

« Hide

Isoform 2 (PGK-10A) [UniParc].

Checksum: 051F76900C2AFEA9
Show »

FASTA22324,674
Isoform 3 [UniParc].

Checksum: 00D2AE5561DB788E
Show »

FASTA16418,162
Isoform 4 [UniParc].

Checksum: B978EFD702D36903
Show »

FASTA15917,301

References

« Hide 'large scale' references
[1]"Primary structure of a human glandular kallikrein gene."
Schedlich L.J., Bennetts B.H., Morris B.J.
DNA 6:429-437(1987) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
[2]"Identification and androgen-regulated expression of two major human glandular kallikrein-1 (hGK-1) mRNA species."
Riegman P.H., Vlietstra R.J., der Korput H.A., Romijn J.C., Trapman J.
Mol. Cell. Endocrinol. 76:181-190(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Prostate.
[3]"Identification of three new alternate human kallikrein 2 transcripts: evidence of long transcript and alternative splicing."
Liu X.F., Essand M., Vasmatzis G., Lee B., Pastan I.
Biochem. Biophys. Res. Commun. 264:833-839(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
[4]"Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[5]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Tissue: Prostate.
[7]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Prostate.
[9]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
[10]"Characterization of single-nucleotide polymorphisms in coding regions of human genes."
Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.
Nat. Genet. 22:231-238(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT LEU-18.
[11]Erratum
Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.
Nat. Genet. 23:373-373(1999)
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M18156 Genomic DNA. No translation available.
M18157 Genomic DNA. Translation: AAA74454.1.
S39329 mRNA. Translation: AAD13816.1.
S39329 mRNA. Translation: AAD13817.1. Sequence problems.
AF188745 mRNA. Translation: AAF08275.1.
AF188746 mRNA. Translation: AAF08276.1.
AF188747 mRNA. Translation: AAF08277.1.
AF243527 Genomic DNA. Translation: AAG33356.1.
BT006650 mRNA. Translation: AAP35296.1.
AK300549 mRNA. Translation: BAG62255.1.
AK300566 mRNA. Translation: BAG62272.1.
AC037199 Genomic DNA. No translation available.
BC005196 mRNA. Translation: AAH05196.1.
PIRA29586.
RefSeqNP_001002231.1. NM_001002231.2.
NP_001243009.1. NM_001256080.1.
NP_005542.1. NM_005551.4.
UniGeneHs.515560.

3D structure databases

ProteinModelPortalP20151.
SMRP20151. Positions 25-261.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110017. 5 interactions.
STRING9606.ENSP00000313581.

Chemistry

BindingDBP20151.
ChEMBLCHEMBL2442.

Protein family/group databases

MEROPSS01.161.

PTM databases

PhosphoSiteP20151.

Polymorphism databases

DMDM125174.

Proteomic databases

PaxDbP20151.
PRIDEP20151.

Protocols and materials databases

DNASU3817.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000325321; ENSP00000313581; ENSG00000167751. [P20151-1]
ENST00000358049; ENSP00000350748; ENSG00000167751. [P20151-2]
ENST00000391810; ENSP00000375686; ENSG00000167751. [P20151-4]
ENST00000597439; ENSP00000471214; ENSG00000167751. [P20151-3]
GeneID3817.
KEGGhsa:3817.
UCSCuc002ptu.3. human. [P20151-2]
uc002ptv.3. human. [P20151-1]

Organism-specific databases

CTD3817.
GeneCardsGC19P051376.
HGNCHGNC:6363. KLK2.
HPAHPA000764.
MIM147960. gene.
neXtProtNX_P20151.
PharmGKBPA30152.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5640.
HOGENOMHOG000251820.
HOVERGENHBG013304.
InParanoidP20151.
KOK01325.
OMAVHYQKWI.
PhylomeDBP20151.
TreeFamTF331065.

Enzyme and pathway databases

ReactomeREACT_118779. Extracellular matrix organization.
REACT_17015. Metabolism of proteins.

Gene expression databases

ArrayExpressP20151.
BgeeP20151.
CleanExHS_KLK2.
GenevestigatorP20151.

Family and domain databases

InterProIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSPR00722. CHYMOTRYPSIN.
SMARTSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMSSF50494. SSF50494. 1 hit.
PROSITEPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKLK2. human.
GenomeRNAi3817.
NextBio15005.
PMAP-CutDBP20151.
PROP20151.
SOURCESearch...

Entry information

Entry nameKLK2_HUMAN
AccessionPrimary (citable) accession number: P20151
Secondary accession number(s): B4DU93 expand/collapse secondary AC list , B4DUB0, F5H8L3, Q15946, Q9UJZ9
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: March 19, 2014
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM