Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P20151

- KLK2_HUMAN

UniProt

P20151 - KLK2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Kallikrein-2

Gene

KLK2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Catalytic activityi

Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei65 – 651Charge relay system
Active sitei120 – 1201Charge relay system
Active sitei213 – 2131Charge relay system

GO - Molecular functioni

  1. serine-type endopeptidase activity Source: BHF-UCL

GO - Biological processi

  1. extracellular matrix disassembly Source: Reactome
  2. extracellular matrix organization Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Enzyme and pathway databases

ReactomeiREACT_118682. Activation of Matrix Metalloproteinases.
REACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Protein family/group databases

MEROPSiS01.161.

Names & Taxonomyi

Protein namesi
Recommended name:
Kallikrein-2 (EC:3.4.21.35)
Alternative name(s):
Glandular kallikrein-1
Short name:
hGK-1
Tissue kallikrein-2
Gene namesi
Name:KLK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:6363. KLK2.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. extracellular vesicular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30152.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818CuratedAdd
BLAST
Propeptidei19 – 246Activation peptideCuratedPRO_0000027929
Chaini25 – 261237Kallikrein-2PRO_0000027930Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi31 ↔ 173PROSITE-ProRule annotation
Disulfide bondi50 ↔ 66PROSITE-ProRule annotation
Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi152 ↔ 219PROSITE-ProRule annotation
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation
Disulfide bondi209 ↔ 234PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

MaxQBiP20151.
PaxDbiP20151.
PRIDEiP20151.

PTM databases

PhosphoSiteiP20151.

Miscellaneous databases

PMAP-CutDBP20151.

Expressioni

Gene expression databases

BgeeiP20151.
CleanExiHS_KLK2.
ExpressionAtlasiP20151. baseline and differential.
GenevestigatoriP20151.

Organism-specific databases

HPAiHPA000764.

Interactioni

Protein-protein interaction databases

BioGridi110017. 11 interactions.
STRINGi9606.ENSP00000313581.

Structurei

3D structure databases

ProteinModelPortaliP20151.
SMRiP20151. Positions 25-261.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 258234Peptidase S1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG5640.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP20151.
KOiK01325.
OMAiVHYQKWI.
PhylomeDBiP20151.
TreeFamiTF331065.

Family and domain databases

InterProiIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P20151-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWDLVLSIAL SVGCTGAVPL IQSRIVGGWE CEKHSQPWQV AVYSHGWAHC
60 70 80 90 100
GGVLVHPQWV LTAAHCLKKN SQVWLGRHNL FEPEDTGQRV PVSHSFPHPL
110 120 130 140 150
YNMSLLKHQS LRPDEDSSHD LMLLRLSEPA KITDVVKVLG LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLRPRS LQCVSLHLLS NDMCARAYSE KVTEFMLCAG
210 220 230 240 250
LWTGGKDTCG GDSGGPLVCN GVLQGITSWG PEPCALPEKP AVYTKVVHYR
260
KWIKDTIAAN P
Length:261
Mass (Da):28,671
Last modified:February 1, 1991 - v1
Checksum:i9CF7F4A1162EF42D
GO
Isoform 2 (identifier: P20151-2) [UniParc]FASTAAdd to Basket

Also known as: PGK-10A

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP → VSHPYSQHLEGKG

Show »
Length:223
Mass (Da):24,674
Checksum:i051F76900C2AFEA9
GO
Isoform 3 (identifier: P20151-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-261: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:164
Mass (Da):18,162
Checksum:i00D2AE5561DB788E
GO
Isoform 4 (identifier: P20151-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.

Note: No experimental confirmation available.

Show »
Length:159
Mass (Da):17,301
Checksum:iB978EFD702D36903
GO

Sequence cautioni

The sequence AAD13817.1 differs from that shown. Reason: Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti143 – 1431T → A in BAG62255. (PubMed:14702039)Curated
Isoform 2 (identifier: P20151-2)
Sequence conflicti223 – 2231G → GE in BAG62272. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti18 – 181V → L.1 Publication
Corresponds to variant rs6072 [ dbSNP | Ensembl ].
VAR_014164
Natural varianti250 – 2501R → W.
Corresponds to variant rs198977 [ dbSNP | Ensembl ].
VAR_020178
Natural varianti255 – 2551D → A.
Corresponds to variant rs60268688 [ dbSNP | Ensembl ].
VAR_061775

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 102102Missing in isoform 4. 1 PublicationVSP_044709Add
BLAST
Alternative sequencei165 – 26197Missing in isoform 3. CuratedVSP_005400Add
BLAST
Alternative sequencei211 – 26151GDSGG…IAANP → VSHPYSQHLEGKG in isoform 2. 2 PublicationsVSP_005399Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M18156 Genomic DNA. No translation available.
M18157 Genomic DNA. Translation: AAA74454.1.
S39329 mRNA. Translation: AAD13816.1.
S39329 mRNA. Translation: AAD13817.1. Sequence problems.
AF188745 mRNA. Translation: AAF08275.1.
AF188746 mRNA. Translation: AAF08276.1.
AF188747 mRNA. Translation: AAF08277.1.
AF243527 Genomic DNA. Translation: AAG33356.1.
BT006650 mRNA. Translation: AAP35296.1.
AK300549 mRNA. Translation: BAG62255.1.
AK300566 mRNA. Translation: BAG62272.1.
AC037199 Genomic DNA. No translation available.
BC005196 mRNA. Translation: AAH05196.1.
CCDSiCCDS12808.1. [P20151-1]
CCDS42597.1. [P20151-2]
CCDS58675.1. [P20151-4]
PIRiA29586.
RefSeqiNP_001002231.1. NM_001002231.2. [P20151-2]
NP_001243009.1. NM_001256080.1. [P20151-4]
NP_005542.1. NM_005551.4. [P20151-1]
XP_006723272.1. XM_006723209.1. [P20151-3]
UniGeneiHs.515560.

Genome annotation databases

EnsembliENST00000325321; ENSP00000313581; ENSG00000167751. [P20151-1]
ENST00000358049; ENSP00000350748; ENSG00000167751. [P20151-2]
ENST00000391810; ENSP00000375686; ENSG00000167751. [P20151-4]
ENST00000597439; ENSP00000471214; ENSG00000167751. [P20151-3]
GeneIDi3817.
KEGGihsa:3817.
UCSCiuc002ptu.3. human. [P20151-2]
uc002ptv.3. human. [P20151-1]

Polymorphism databases

DMDMi125174.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M18156 Genomic DNA. No translation available.
M18157 Genomic DNA. Translation: AAA74454.1 .
S39329 mRNA. Translation: AAD13816.1 .
S39329 mRNA. Translation: AAD13817.1 . Sequence problems.
AF188745 mRNA. Translation: AAF08275.1 .
AF188746 mRNA. Translation: AAF08276.1 .
AF188747 mRNA. Translation: AAF08277.1 .
AF243527 Genomic DNA. Translation: AAG33356.1 .
BT006650 mRNA. Translation: AAP35296.1 .
AK300549 mRNA. Translation: BAG62255.1 .
AK300566 mRNA. Translation: BAG62272.1 .
AC037199 Genomic DNA. No translation available.
BC005196 mRNA. Translation: AAH05196.1 .
CCDSi CCDS12808.1. [P20151-1 ]
CCDS42597.1. [P20151-2 ]
CCDS58675.1. [P20151-4 ]
PIRi A29586.
RefSeqi NP_001002231.1. NM_001002231.2. [P20151-2 ]
NP_001243009.1. NM_001256080.1. [P20151-4 ]
NP_005542.1. NM_005551.4. [P20151-1 ]
XP_006723272.1. XM_006723209.1. [P20151-3 ]
UniGenei Hs.515560.

3D structure databases

ProteinModelPortali P20151.
SMRi P20151. Positions 25-261.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110017. 11 interactions.
STRINGi 9606.ENSP00000313581.

Chemistry

BindingDBi P20151.
ChEMBLi CHEMBL2442.

Protein family/group databases

MEROPSi S01.161.

PTM databases

PhosphoSitei P20151.

Polymorphism databases

DMDMi 125174.

Proteomic databases

MaxQBi P20151.
PaxDbi P20151.
PRIDEi P20151.

Protocols and materials databases

DNASUi 3817.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000325321 ; ENSP00000313581 ; ENSG00000167751 . [P20151-1 ]
ENST00000358049 ; ENSP00000350748 ; ENSG00000167751 . [P20151-2 ]
ENST00000391810 ; ENSP00000375686 ; ENSG00000167751 . [P20151-4 ]
ENST00000597439 ; ENSP00000471214 ; ENSG00000167751 . [P20151-3 ]
GeneIDi 3817.
KEGGi hsa:3817.
UCSCi uc002ptu.3. human. [P20151-2 ]
uc002ptv.3. human. [P20151-1 ]

Organism-specific databases

CTDi 3817.
GeneCardsi GC19P051369.
HGNCi HGNC:6363. KLK2.
HPAi HPA000764.
MIMi 147960. gene.
neXtProti NX_P20151.
PharmGKBi PA30152.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5640.
GeneTreei ENSGT00760000118862.
HOGENOMi HOG000251820.
HOVERGENi HBG013304.
InParanoidi P20151.
KOi K01325.
OMAi VHYQKWI.
PhylomeDBi P20151.
TreeFami TF331065.

Enzyme and pathway databases

Reactomei REACT_118682. Activation of Matrix Metalloproteinases.
REACT_15428. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Miscellaneous databases

ChiTaRSi KLK2. human.
GenomeRNAii 3817.
NextBioi 15005.
PMAP-CutDB P20151.
PROi P20151.
SOURCEi Search...

Gene expression databases

Bgeei P20151.
CleanExi HS_KLK2.
ExpressionAtlasi P20151. baseline and differential.
Genevestigatori P20151.

Family and domain databases

InterProi IPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view ]
Pfami PF00089. Trypsin. 1 hit.
[Graphical view ]
PRINTSi PR00722. CHYMOTRYPSIN.
SMARTi SM00020. Tryp_SPc. 1 hit.
[Graphical view ]
SUPFAMi SSF50494. SSF50494. 1 hit.
PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Primary structure of a human glandular kallikrein gene."
    Schedlich L.J., Bennetts B.H., Morris B.J.
    DNA 6:429-437(1987) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  2. "Identification and androgen-regulated expression of two major human glandular kallikrein-1 (hGK-1) mRNA species."
    Riegman P.H., Vlietstra R.J., der Korput H.A., Romijn J.C., Trapman J.
    Mol. Cell. Endocrinol. 76:181-190(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Prostate.
  3. "Identification of three new alternate human kallikrein 2 transcripts: evidence of long transcript and alternative splicing."
    Liu X.F., Essand M., Vasmatzis G., Lee B., Pastan I.
    Biochem. Biophys. Res. Commun. 264:833-839(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
  4. "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region."
    Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K.
    Gene 257:119-130(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Prostate.
  7. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  9. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  10. Cited for: VARIANT LEU-18.

Entry informationi

Entry nameiKLK2_HUMAN
AccessioniPrimary (citable) accession number: P20151
Secondary accession number(s): B4DU93
, B4DUB0, F5H8L3, Q15946, Q9UJZ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 26, 2014
This is version 152 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3