Reviewed,
UniProtKB/Swiss-Prot P20151 (KLK2_HUMAN)
Last modified
November 3, 2009.
Version 102.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Kallikrein-2 EC=3.4.21.35 Alternative name(s): Tissue kallikrein-2 Glandular kallikrein-1 Short name=hGK-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 261 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. |
| Catalytic activity | Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. |
| Sequence similarities | Belongs to the peptidase S1 family. Kallikrein subfamily. Contains 1 peptidase S1 domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Hydrolase Protease Serine protease |
| PTM | Disulfide bond Glycoprotein Zymogen |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | proteolysis Inferred from electronic annotation. Source: InterPro |
| Molecular function | serine-type endopeptidase activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P20151-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P20151-2) Also known as: PGK-10A; The sequence of this isoform differs from the canonical sequence as follows: 211-261: GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP → VSHPYSQHLEGK | ||||||
| Isoform 3 (identifier: P20151-3) The sequence of this isoform differs from the canonical sequence as follows: 165-261: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Probable | ||||||||
| Propeptide | 19 – 24 | 6 | Activation peptide Probable | PRO_0000027929 | |||||||
| Chain | 25 – 261 | 237 | Kallikrein-2 | PRO_0000027930 | |||||||
Regions | |||||||||||
| Domain | 25 – 258 | 234 | Peptidase S1 | ||||||||
Sites | |||||||||||
| Active site | 65 | 1 | Charge relay system | ||||||||
| Active site | 120 | 1 | Charge relay system | ||||||||
| Active site | 213 | 1 | Charge relay system | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 31 ↔ 173 | By similarity | |||||||||
| Disulfide bond | 50 ↔ 66 | By similarity | |||||||||
| Disulfide bond | 152 ↔ 219 | By similarity | |||||||||
| Disulfide bond | 184 ↔ 198 | By similarity | |||||||||
| Disulfide bond | 209 ↔ 234 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 165 – 261 | 97 | Missing in isoform 3. | VSP_005400 | |||||||
| Alternative sequence | 211 – 261 | 51 | GDSGG…IAANP → VSHPYSQHLEGK in isoform 2. | VSP_005399 | |||||||
| Natural variant | 18 | 1 | V → L: dbSNP rs6072. Ref.9 | VAR_014164 | |||||||
| Natural variant | 250 | 1 | R → W: dbSNP rs198977. | VAR_020178 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Primary structure of a human glandular kallikrein gene." Schedlich L.J., Bennetts B.H., Morris B.J. DNA 6:429-437(1987) [PubMed: 2824146] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Identification and androgen-regulated expression of two major human glandular kallikrein-1 (hGK-1) mRNA species." Riegman P.H., Vlietstra R.J., der Korput H.A., Romijn J.C., Trapman J. Mol. Cell. Endocrinol. 76:181-190(1991) [PubMed: 1726490] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Prostate. |
| [3] | "Identification of three new alternate human kallikrein 2 transcripts: evidence of long transcript and alternative splicing." Liu X.F., Essand M., Vasmatzis G., Lee B., Pastan I. Biochem. Biophys. Res. Commun. 264:833-839(1999) [PubMed: 10544017] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [4] | "Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region." Gan L., Lee I., Smith R., Argonza-Barrett R., Lei H., McCuaig J., Moss P., Paeper B., Wang K. Gene 257:119-130(2000) [PubMed: 11054574] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed: 15057824] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Prostate. |
| [8] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [9] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed: 10391209] [Abstract] Cited for: VARIANT LEU-18. |
| [10] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| M18156 Genomic DNA. No translation available. M18157 Genomic DNA. Translation: AAA74454.1. S39329 mRNA. Translation: AAD13816.1. S39329 mRNA. Translation: AAD13817.1. AF188745 mRNA. Translation: AAF08275.1. AF188746 mRNA. Translation: AAF08276.1. AF188747 mRNA. Translation: AAF08277.1. AF243527 Genomic DNA. Translation: AAG33356.1. BT006650 mRNA. Translation: AAP35296.1. AC037199 Genomic DNA. No translation available. BC005196 mRNA. Translation: AAH05196.1. | |
| IPI | IPI00022227. IPI00219231. IPI00941408. |
| PIR | A29586. |
| RefSeq | NP_001002231.1. NP_005542.1. |
| UniGene | Hs.515560 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1EZX based on UniProtKB P00760. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P20151. |
Protein family/group databases | |
| MEROPS | S01.161. |
PTM databases | |
| PhosphoSite | P20151. |
Proteomic databases | |
| PRIDE | P20151. |
Genome annotation databases | |
| Ensembl | ENST00000325321; ENSP00000313581; ENSG00000167751; Homo sapiens. [Genome view] ENST00000358049; ENSP00000350748; ENSG00000167751; Homo sapiens. [Genome view] ENST00000391810; ENSP00000375686; ENSG00000167751; Homo sapiens. [Genome view] ENST00000423722; ENSP00000395423; ENSG00000167751; Homo sapiens. [Genome view] |
| GeneID | 3817. |
| KEGG | hsa:3817. |
| UCSC | uc002ptu.1. human. uc002ptv.1. human. |
Organism-specific databases | |
| CTD | 3817. |
| GeneCards | GC19P056068. |
| H-InvDB | HIX0015370. |
| HGNC | HGNC:6363. KLK2. |
| HPA | HPA000764. |
| MIM | 147960. gene. |
| PharmGKB | PA30152. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P20151. |
| HOVERGEN | P20151. |
| OMA | AYSEKVT. |
Enzyme and pathway databases | |
| BRENDA | 3.4.21.35. 247. |
| Pathway_Interaction_DB | ar_pathway. Coregulation of Androgen receptor activity. ar_tf_pathway. Regulation of Androgen receptor activity. |
Gene expression databases | |
| ArrayExpress | P20151. |
| Bgee | P20151. |
| CleanEx | HS_KLK2. |
| Genevestigator | P20151. |
| GermOnline | ENSG00000167751. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018114. Peptidase_S1/S6_AS. IPR001254. Peptidase_S1_S6. IPR001314. Peptidase_S1A. [Graphical view] |
| Pfam | PF00089. Trypsin. 1 hit. [Graphical view] |
| PRINTS | PR00722. CHYMOTRYPSIN. |
| SMART | SM00020. Tryp_SPc. 1 hit. [Graphical view] |
| PROSITE | PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 15005. |
| PMAP-CutDB | P20151. |
| SOURCE | Search... |
Entry information
| Entry name | KLK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P20151 Secondary accession number(s): Q15946, Q9UJZ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


