Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kallikrein-2

Gene

KLK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Catalytic activityi

Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei65Charge relay system1
Active sitei120Charge relay system1
Active sitei213Charge relay system1

GO - Molecular functioni

  • serine-type endopeptidase activity Source: BHF-UCL

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Enzyme and pathway databases

BioCyciZFISH:HS09622-MONOMER.
ReactomeiR-HSA-1592389. Activation of Matrix Metalloproteinases.
R-HSA-381426. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).
R-HSA-5625886. Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3.
SIGNORiP20151.

Protein family/group databases

MEROPSiS01.161.

Names & Taxonomyi

Protein namesi
Recommended name:
Kallikrein-2 (EC:3.4.21.35)
Alternative name(s):
Glandular kallikrein-1
Short name:
hGK-1
Tissue kallikrein-2
Gene namesi
Name:KLK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:6363. KLK2.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • extracellular region Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi3817.
OpenTargetsiENSG00000167751.
PharmGKBiPA30152.

Protein family/group databases

Allergomei2836. Hom s PSA.

Chemistry databases

ChEMBLiCHEMBL2442.
GuidetoPHARMACOLOGYi2372.

Polymorphism and mutation databases

BioMutaiKLK2.
DMDMi125174.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18CuratedAdd BLAST18
PropeptideiPRO_000002792919 – 24Activation peptideCurated6
ChainiPRO_000002793025 – 261Kallikrein-2Add BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi31 ↔ 173PROSITE-ProRule annotation
Disulfide bondi50 ↔ 66PROSITE-ProRule annotation
Glycosylationi102N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi152 ↔ 219PROSITE-ProRule annotation
Disulfide bondi184 ↔ 198PROSITE-ProRule annotation
Disulfide bondi209 ↔ 234PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

MaxQBiP20151.
PaxDbiP20151.
PeptideAtlasiP20151.
PRIDEiP20151.

PTM databases

iPTMnetiP20151.
PhosphoSitePlusiP20151.

Miscellaneous databases

PMAP-CutDBP20151.

Expressioni

Gene expression databases

BgeeiENSG00000167751.
CleanExiHS_KLK2.
ExpressionAtlasiP20151. baseline and differential.
GenevisibleiP20151. HS.

Organism-specific databases

HPAiHPA000764.

Interactioni

Protein-protein interaction databases

BioGridi110017. 11 interactors.
STRINGi9606.ENSP00000313581.

Chemistry databases

BindingDBiP20151.

Structurei

Secondary structure

1261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi39 – 44Combined sources6
Beta strandi47 – 56Combined sources10
Beta strandi59 – 62Combined sources4
Helixi64 – 66Combined sources3
Beta strandi72 – 76Combined sources5
Beta strandi88 – 97Combined sources10
Helixi103 – 105Combined sources3
Beta strandi122 – 128Combined sources7
Beta strandi134 – 136Combined sources3
Beta strandi151 – 158Combined sources8
Beta strandi160 – 164Combined sources5
Beta strandi172 – 179Combined sources8
Helixi181 – 187Combined sources7
Beta strandi196 – 200Combined sources5
Beta strandi216 – 219Combined sources4
Beta strandi222 – 229Combined sources8
Beta strandi241 – 245Combined sources5
Helixi246 – 249Combined sources4
Helixi250 – 259Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NFEX-ray1.90A25-261[»]
4NFFX-ray1.90A25-261[»]
ProteinModelPortaliP20151.
SMRiP20151.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 258Peptidase S1PROSITE-ProRule annotationAdd BLAST234

Sequence similaritiesi

Belongs to the peptidase S1 family. Kallikrein subfamily.PROSITE-ProRule annotation
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP20151.
KOiK01325.
OMAiVHYQKWI.
OrthoDBiEOG091G0DF7.
PhylomeDBiP20151.
TreeFamiTF331065.

Family and domain databases

CDDicd00190. Tryp_SPc. 1 hit.
InterProiIPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR001254. Trypsin_dom.
IPR018114. TRYPSIN_HIS.
IPR033116. TRYPSIN_SER.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P20151-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWDLVLSIAL SVGCTGAVPL IQSRIVGGWE CEKHSQPWQV AVYSHGWAHC
60 70 80 90 100
GGVLVHPQWV LTAAHCLKKN SQVWLGRHNL FEPEDTGQRV PVSHSFPHPL
110 120 130 140 150
YNMSLLKHQS LRPDEDSSHD LMLLRLSEPA KITDVVKVLG LPTQEPALGT
160 170 180 190 200
TCYASGWGSI EPEEFLRPRS LQCVSLHLLS NDMCARAYSE KVTEFMLCAG
210 220 230 240 250
LWTGGKDTCG GDSGGPLVCN GVLQGITSWG PEPCALPEKP AVYTKVVHYR
260
KWIKDTIAAN P
Length:261
Mass (Da):28,671
Last modified:February 1, 1991 - v1
Checksum:i9CF7F4A1162EF42D
GO
Isoform 2 (identifier: P20151-2) [UniParc]FASTAAdd to basket
Also known as: PGK-10A

The sequence of this isoform differs from the canonical sequence as follows:
     211-261: GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP → VSHPYSQHLEGKG

Show »
Length:223
Mass (Da):24,674
Checksum:i051F76900C2AFEA9
GO
Isoform 3 (identifier: P20151-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-261: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:164
Mass (Da):18,162
Checksum:i00D2AE5561DB788E
GO
Isoform 4 (identifier: P20151-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.

Note: No experimental confirmation available.
Show »
Length:159
Mass (Da):17,301
Checksum:iB978EFD702D36903
GO

Sequence cautioni

The sequence AAD13817 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti143T → A in BAG62255 (PubMed:14702039).Curated1
Isoform 2 (identifier: P20151-2)
Sequence conflicti223G → GE in BAG62272 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01416418V → L.1 PublicationCorresponds to variant rs6072dbSNPEnsembl.1
Natural variantiVAR_020178250R → W.Corresponds to variant rs198977dbSNPEnsembl.1
Natural variantiVAR_061775255D → A.Corresponds to variant rs60268688dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447091 – 102Missing in isoform 4. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_005400165 – 261Missing in isoform 3. CuratedAdd BLAST97
Alternative sequenceiVSP_005399211 – 261GDSGG…IAANP → VSHPYSQHLEGKG in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M18156 Genomic DNA. No translation available.
M18157 Genomic DNA. Translation: AAA74454.1.
S39329 mRNA. Translation: AAD13816.1.
S39329 mRNA. Translation: AAD13817.1. Sequence problems.
AF188745 mRNA. Translation: AAF08275.1.
AF188746 mRNA. Translation: AAF08276.1.
AF188747 mRNA. Translation: AAF08277.1.
AF243527 Genomic DNA. Translation: AAG33356.1.
BT006650 mRNA. Translation: AAP35296.1.
AK300549 mRNA. Translation: BAG62255.1.
AK300566 mRNA. Translation: BAG62272.1.
AC037199 Genomic DNA. No translation available.
BC005196 mRNA. Translation: AAH05196.1.
CCDSiCCDS12808.1. [P20151-1]
CCDS42597.1. [P20151-2]
CCDS58675.1. [P20151-4]
PIRiA29586.
RefSeqiNP_001002231.1. NM_001002231.2. [P20151-2]
NP_001243009.1. NM_001256080.1. [P20151-4]
NP_005542.1. NM_005551.4. [P20151-1]
UniGeneiHs.515560.

Genome annotation databases

EnsembliENST00000325321; ENSP00000313581; ENSG00000167751. [P20151-1]
ENST00000358049; ENSP00000350748; ENSG00000167751. [P20151-2]
ENST00000391810; ENSP00000375686; ENSG00000167751. [P20151-4]
ENST00000597439; ENSP00000471214; ENSG00000167751. [P20151-3]
GeneIDi3817.
KEGGihsa:3817.
UCSCiuc002ptu.4. human. [P20151-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M18156 Genomic DNA. No translation available.
M18157 Genomic DNA. Translation: AAA74454.1.
S39329 mRNA. Translation: AAD13816.1.
S39329 mRNA. Translation: AAD13817.1. Sequence problems.
AF188745 mRNA. Translation: AAF08275.1.
AF188746 mRNA. Translation: AAF08276.1.
AF188747 mRNA. Translation: AAF08277.1.
AF243527 Genomic DNA. Translation: AAG33356.1.
BT006650 mRNA. Translation: AAP35296.1.
AK300549 mRNA. Translation: BAG62255.1.
AK300566 mRNA. Translation: BAG62272.1.
AC037199 Genomic DNA. No translation available.
BC005196 mRNA. Translation: AAH05196.1.
CCDSiCCDS12808.1. [P20151-1]
CCDS42597.1. [P20151-2]
CCDS58675.1. [P20151-4]
PIRiA29586.
RefSeqiNP_001002231.1. NM_001002231.2. [P20151-2]
NP_001243009.1. NM_001256080.1. [P20151-4]
NP_005542.1. NM_005551.4. [P20151-1]
UniGeneiHs.515560.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NFEX-ray1.90A25-261[»]
4NFFX-ray1.90A25-261[»]
ProteinModelPortaliP20151.
SMRiP20151.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110017. 11 interactors.
STRINGi9606.ENSP00000313581.

Chemistry databases

BindingDBiP20151.
ChEMBLiCHEMBL2442.
GuidetoPHARMACOLOGYi2372.

Protein family/group databases

Allergomei2836. Hom s PSA.
MEROPSiS01.161.

PTM databases

iPTMnetiP20151.
PhosphoSitePlusiP20151.

Polymorphism and mutation databases

BioMutaiKLK2.
DMDMi125174.

Proteomic databases

MaxQBiP20151.
PaxDbiP20151.
PeptideAtlasiP20151.
PRIDEiP20151.

Protocols and materials databases

DNASUi3817.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325321; ENSP00000313581; ENSG00000167751. [P20151-1]
ENST00000358049; ENSP00000350748; ENSG00000167751. [P20151-2]
ENST00000391810; ENSP00000375686; ENSG00000167751. [P20151-4]
ENST00000597439; ENSP00000471214; ENSG00000167751. [P20151-3]
GeneIDi3817.
KEGGihsa:3817.
UCSCiuc002ptu.4. human. [P20151-1]

Organism-specific databases

CTDi3817.
DisGeNETi3817.
GeneCardsiKLK2.
HGNCiHGNC:6363. KLK2.
HPAiHPA000764.
MIMi147960. gene.
neXtProtiNX_P20151.
OpenTargetsiENSG00000167751.
PharmGKBiPA30152.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP20151.
KOiK01325.
OMAiVHYQKWI.
OrthoDBiEOG091G0DF7.
PhylomeDBiP20151.
TreeFamiTF331065.

Enzyme and pathway databases

BioCyciZFISH:HS09622-MONOMER.
ReactomeiR-HSA-1592389. Activation of Matrix Metalloproteinases.
R-HSA-381426. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).
R-HSA-5625886. Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3.
SIGNORiP20151.

Miscellaneous databases

ChiTaRSiKLK2. human.
GenomeRNAii3817.
PMAP-CutDBP20151.
PROiP20151.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167751.
CleanExiHS_KLK2.
ExpressionAtlasiP20151. baseline and differential.
GenevisibleiP20151. HS.

Family and domain databases

CDDicd00190. Tryp_SPc. 1 hit.
InterProiIPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR001254. Trypsin_dom.
IPR018114. TRYPSIN_HIS.
IPR033116. TRYPSIN_SER.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLK2_HUMAN
AccessioniPrimary (citable) accession number: P20151
Secondary accession number(s): B4DU93
, B4DUB0, F5H8L3, Q15946, Q9UJZ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: February 1, 1991
Last modified: November 2, 2016
This is version 168 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.