Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P20138

- CD33_HUMAN

UniProt

P20138 - CD33_HUMAN

Protein

Myeloid cell surface antigen CD33

Gene

CD33

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 156 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei119 – 1191Sialic acidBy similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. receptor activity Source: ProtInc

    GO - Biological processi

    1. cell adhesion Source: ProtInc
    2. cell-cell signaling Source: ProtInc
    3. negative regulation of cell proliferation Source: ProtInc
    4. signal transduction Source: ProtInc

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Lectin

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Myeloid cell surface antigen CD33
    Alternative name(s):
    Sialic acid-binding Ig-like lectin 3
    Short name:
    Siglec-3
    gp67
    CD_antigen: CD33
    Gene namesi
    Name:CD33
    Synonyms:SIGLEC3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:1659. CD33.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: MGI
    2. extracellular vesicular exosome Source: UniProt
    3. integral component of plasma membrane Source: ProtInc
    4. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi340 – 3401Y → A: Abolishes binding to PTPN6 and PTPN11. Increases binding of red blood cells. 1 Publication
    Mutagenesisi358 – 3581Y → A or F: Reduces binding to PTPN6. 1 Publication

    Organism-specific databases

    PharmGKBiPA26210.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1717Sequence AnalysisAdd
    BLAST
    Chaini18 – 364347Myeloid cell surface antigen CD33PRO_0000014878Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi36 ↔ 169PROSITE-ProRule annotation
    Disulfide bondi41 ↔ 101PROSITE-ProRule annotation
    Glycosylationi100 – 1001N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi113 – 1131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi160 – 1601N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi163 ↔ 212PROSITE-ProRule annotation
    Glycosylationi209 – 2091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi230 – 2301N-linked (GlcNAc...)Sequence Analysis
    Modified residuei340 – 3401Phosphotyrosine2 Publications
    Modified residuei358 – 3581Phosphotyrosine2 Publications

    Post-translational modificationi

    Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.2 Publications

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP20138.
    PRIDEiP20138.

    PTM databases

    PhosphoSiteiP20138.

    Expressioni

    Tissue specificityi

    Monocytic/myeloid lineage cells.

    Gene expression databases

    ArrayExpressiP20138.
    BgeeiP20138.
    CleanExiHS_CD33.
    GenevestigatoriP20138.

    Organism-specific databases

    HPAiCAB011442.
    HPA035832.

    Interactioni

    Subunit structurei

    Interacts with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PTPN11Q061245EBI-3906571,EBI-297779
    PTPN6P293508EBI-3906571,EBI-78260

    Protein-protein interaction databases

    BioGridi107383. 5 interactions.
    IntActiP20138. 3 interactions.
    MINTiMINT-8020077.
    STRINGi9606.ENSP00000262262.

    Structurei

    3D structure databases

    ProteinModelPortaliP20138.
    SMRiP20138. Positions 20-232.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini18 – 259242ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini283 – 36482CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei260 – 28223HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini19 – 135117Ig-like V-typeAdd
    BLAST
    Domaini145 – 22884Ig-like C2-typeAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi338 – 3436ITIM motif 1
    Motifi356 – 3616ITIM motif 2

    Domaini

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG320441.
    HOGENOMiHOG000236324.
    HOVERGENiHBG036161.
    InParanoidiP20138.
    KOiK06473.
    OMAiDEELHYA.
    OrthoDBiEOG73JKV5.
    PhylomeDBiP20138.
    TreeFamiTF332441.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR013151. Immunoglobulin.
    [Graphical view]
    PfamiPF00047. ig. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 2 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P20138-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPLLLLLPLL WAGALAMDPN FWLQVQESVT VQEGLCVLVP CTFFHPIPYY    50
    DKNSPVHGYW FREGAIISRD SPVATNKLDQ EVQEETQGRF RLLGDPSRNN 100
    CSLSIVDARR RDNGSYFFRM ERGSTKYSYK SPQLSVHVTD LTHRPKILIP 150
    GTLEPGHSKN LTCSVSWACE QGTPPIFSWL SAAPTSLGPR TTHSSVLIIT 200
    PRPQDHGTNL TCQVKFAGAG VTTERTIQLN VTYVPQNPTT GIFPGDGSGK 250
    QETRAGVVHG AIGGAGVTAL LALCLCLIFF IVKTHRRKAA RTAVGRNDTH 300
    PTTGSASPKH QKKSKLHGPT ETSSCSGAAP TVEMDEELHY ASLNFHGMNP 350
    SKDTSTEYSE VRTQ 364
    Length:364
    Mass (Da):39,825
    Last modified:October 17, 2006 - v2
    Checksum:i1C73E588240FBAD8
    GO
    Isoform 2 (identifier: P20138-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         309-364: KHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ → VR

    Note: No experimental confirmation available.

    Show »
    Length:310
    Mass (Da):33,890
    Checksum:iF3618D0661DBE51E
    GO
    Isoform 3 (identifier: P20138-3) [UniParc]FASTAAdd to Basket

    Also known as: CD33-m

    The sequence of this isoform differs from the canonical sequence as follows:
         13-139: Missing.

    Note: Mostly detected on NKL and myeloid cell lines but poorly expressed on B-cell lines and T-lymphocytes.

    Show »
    Length:237
    Mass (Da):25,293
    Checksum:i52C8CF965ACC740C
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti14 – 141A → V.1 Publication
    Corresponds to variant rs12459419 [ dbSNP | Ensembl ].
    VAR_049904
    Natural varianti22 – 221W → R.
    Corresponds to variant rs35814802 [ dbSNP | Ensembl ].
    VAR_049905
    Natural varianti69 – 691R → G.2 Publications
    Corresponds to variant rs2455069 [ dbSNP | Ensembl ].
    VAR_028260
    Natural varianti128 – 1281S → N.
    Corresponds to variant rs34919259 [ dbSNP | Ensembl ].
    VAR_049906
    Natural varianti202 – 2021R → W.
    Corresponds to variant rs4082929 [ dbSNP | Ensembl ].
    VAR_028261
    Natural varianti242 – 2421I → L.
    Corresponds to variant rs988337 [ dbSNP | Ensembl ].
    VAR_028262
    Natural varianti243 – 2431F → L.
    Corresponds to variant rs11882250 [ dbSNP | Ensembl ].
    VAR_028263
    Natural varianti267 – 2671V → I.
    Corresponds to variant rs58981829 [ dbSNP | Ensembl ].
    VAR_061319
    Natural varianti294 – 2941V → L.
    Corresponds to variant rs2271652 [ dbSNP | Ensembl ].
    VAR_028264
    Natural varianti304 – 3041G → R.1 Publication
    Corresponds to variant rs35112940 [ dbSNP | Ensembl ].
    VAR_049907
    Natural varianti331 – 3311T → A.
    Corresponds to variant rs35632246 [ dbSNP | Ensembl ].
    VAR_049908

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei13 – 139127Missing in isoform 3. 1 PublicationVSP_046172Add
    BLAST
    Alternative sequencei309 – 36456KHQKK…EVRTQ → VR in isoform 2. 1 PublicationVSP_045364Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M23197 mRNA. Translation: AAA51948.1. Sequence problems.
    AY040541 Genomic DNA. Translation: AAK83654.1.
    AY162464 mRNA. No translation available.
    AK304810 mRNA. Translation: BAG65560.1.
    AC063977 Genomic DNA. No translation available.
    CH471135 Genomic DNA. Translation: EAW71996.1.
    BC028152 mRNA. Translation: AAH28152.1.
    CCDSiCCDS33084.1. [P20138-1]
    CCDS46157.1. [P20138-3]
    CCDS54299.1. [P20138-2]
    PIRiA30521.
    RefSeqiNP_001076087.1. NM_001082618.1. [P20138-3]
    NP_001171079.1. NM_001177608.1. [P20138-2]
    NP_001763.3. NM_001772.3. [P20138-1]
    UniGeneiHs.83731.

    Genome annotation databases

    EnsembliENST00000262262; ENSP00000262262; ENSG00000105383. [P20138-1]
    ENST00000391796; ENSP00000375673; ENSG00000105383. [P20138-2]
    ENST00000421133; ENSP00000410126; ENSG00000105383. [P20138-3]
    GeneIDi945.
    KEGGihsa:945.
    UCSCiuc002pwa.2. human. [P20138-1]
    uc010eot.1. human.

    Polymorphism databases

    DMDMi116241290.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Functional Glycomics Gateway - Glycan Binding

    Siglec-3

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M23197 mRNA. Translation: AAA51948.1 . Sequence problems.
    AY040541 Genomic DNA. Translation: AAK83654.1 .
    AY162464 mRNA. No translation available.
    AK304810 mRNA. Translation: BAG65560.1 .
    AC063977 Genomic DNA. No translation available.
    CH471135 Genomic DNA. Translation: EAW71996.1 .
    BC028152 mRNA. Translation: AAH28152.1 .
    CCDSi CCDS33084.1. [P20138-1 ]
    CCDS46157.1. [P20138-3 ]
    CCDS54299.1. [P20138-2 ]
    PIRi A30521.
    RefSeqi NP_001076087.1. NM_001082618.1. [P20138-3 ]
    NP_001171079.1. NM_001177608.1. [P20138-2 ]
    NP_001763.3. NM_001772.3. [P20138-1 ]
    UniGenei Hs.83731.

    3D structure databases

    ProteinModelPortali P20138.
    SMRi P20138. Positions 20-232.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107383. 5 interactions.
    IntActi P20138. 3 interactions.
    MINTi MINT-8020077.
    STRINGi 9606.ENSP00000262262.

    Chemistry

    ChEMBLi CHEMBL1842.
    DrugBanki DB00056. Gemtuzumab ozogamicin.
    GuidetoPHARMACOLOGYi 2601.

    PTM databases

    PhosphoSitei P20138.

    Polymorphism databases

    DMDMi 116241290.

    Proteomic databases

    PaxDbi P20138.
    PRIDEi P20138.

    Protocols and materials databases

    DNASUi 945.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262262 ; ENSP00000262262 ; ENSG00000105383 . [P20138-1 ]
    ENST00000391796 ; ENSP00000375673 ; ENSG00000105383 . [P20138-2 ]
    ENST00000421133 ; ENSP00000410126 ; ENSG00000105383 . [P20138-3 ]
    GeneIDi 945.
    KEGGi hsa:945.
    UCSCi uc002pwa.2. human. [P20138-1 ]
    uc010eot.1. human.

    Organism-specific databases

    CTDi 945.
    GeneCardsi GC19P051729.
    H-InvDB HIX0015379.
    HGNCi HGNC:1659. CD33.
    HPAi CAB011442.
    HPA035832.
    MIMi 159590. gene.
    neXtProti NX_P20138.
    PharmGKBi PA26210.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG320441.
    HOGENOMi HOG000236324.
    HOVERGENi HBG036161.
    InParanoidi P20138.
    KOi K06473.
    OMAi DEELHYA.
    OrthoDBi EOG73JKV5.
    PhylomeDBi P20138.
    TreeFami TF332441.

    Miscellaneous databases

    ChiTaRSi CD33. human.
    GenomeRNAii 945.
    NextBioi 3918.
    PROi P20138.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P20138.
    Bgeei P20138.
    CleanExi HS_CD33.
    Genevestigatori P20138.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    IPR013151. Immunoglobulin.
    [Graphical view ]
    Pfami PF00047. ig. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 2 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of a cDNA encoding CD33, a differentiation antigen of myeloid progenitor cells."
      Simmons D., Seed B.
      J. Immunol. 141:2797-2800(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-69.
      Tissue: Premonocytic lymphoma.
    2. "Genomic organization of the siglec gene locus on chromosome 19q13.4 and cloning of two new siglec pseudogenes."
      Yousef G.M., Ordon M.H., Foussias G., Diamandis E.P.
      Gene 286:259-270(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing."
      Hernandez-Caselles T., Martinez-Esparza M., Perez-Oliva A.B., Quintanilla-Cecconi A.M., Garcia-Alonso A., Alvarez-Lopez D.M., Garcia-Penarrubia P.
      J. Leukoc. Biol. 79:46-58(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS VAL-14 AND ARG-304.
      Tissue: Uterus.
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-69.
      Tissue: Leukocyte.
    8. "Characterization of CD33 as a new member of the sialoadhesin family of cellular interaction molecules."
      Freeman S.D., Kelm S., Barber E.K., Crocker P.R.
      Blood 85:2005-2012(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: SIALIC ACID-BINDING.
    9. "The sialoadhesin CD33 is a myeloid-specific inhibitory receptor."
      Ulyanova T., Blasioli J., Woodford-Thomas T.A., Thomas M.L.
      Eur. J. Immunol. 29:3440-3449(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, PHOSPHORYLATION AT TYR-340 AND TYR-358, MUTAGENESIS OF TYR-358, INTERACTION WITH PTPN6.
    10. "The myeloid-specific sialic acid-binding receptor, CD33, associates with the protein-tyrosine phosphatases, SHP-1 and SHP-2."
      Taylor V.C., Buckley C.D., Douglas M., Cody A.J., Simmons D.L., Freeman S.D.
      J. Biol. Chem. 274:11505-11512(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-340 AND TYR-358, INTERACTION WITH PTPN6 AND PTPN11, MUTAGENESIS OF TYR-340.
    11. "Surface expression and function of p75/AIRM-1 or CD33 in acute myeloid leukemias: engagement of CD33 induces apoptosis of leukemic cells."
      Vitale C., Romagnani C., Puccetti A., Olive D., Costello R., Chiossone L., Pitto A., Bacigalupo A., Moretta L., Mingari M.C.
      Proc. Natl. Acad. Sci. U.S.A. 98:5764-5769(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiCD33_HUMAN
    AccessioniPrimary (citable) accession number: P20138
    Secondary accession number(s): B4E3P8
    , C9JEN7, F8WAL2, Q8TD24
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1991
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 156 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3