Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P20138

- CD33_HUMAN

UniProt

P20138 - CD33_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Myeloid cell surface antigen CD33

Gene

CD33

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei119 – 1191Sialic acidBy similarity

GO - Molecular functioni

  1. carbohydrate binding Source: UniProtKB-KW
  2. receptor activity Source: ProtInc

GO - Biological processi

  1. cell adhesion Source: ProtInc
  2. cell-cell signaling Source: ProtInc
  3. negative regulation of cell proliferation Source: ProtInc
  4. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Lectin

Names & Taxonomyi

Protein namesi
Recommended name:
Myeloid cell surface antigen CD33
Alternative name(s):
Sialic acid-binding Ig-like lectin 3
Short name:
Siglec-3
gp67
CD_antigen: CD33
Gene namesi
Name:CD33
Synonyms:SIGLEC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:1659. CD33.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 259242ExtracellularSequence AnalysisAdd
BLAST
Transmembranei260 – 28223HelicalSequence AnalysisAdd
BLAST
Topological domaini283 – 36482CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. extracellular vesicular exosome Source: UniProt
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi340 – 3401Y → A: Abolishes binding to PTPN6 and PTPN11. Increases binding of red blood cells. 1 Publication
Mutagenesisi358 – 3581Y → A or F: Reduces binding to PTPN6. 1 Publication

Organism-specific databases

PharmGKBiPA26210.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence AnalysisAdd
BLAST
Chaini18 – 364347Myeloid cell surface antigen CD33PRO_0000014878Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi36 ↔ 169PROSITE-ProRule annotation
Disulfide bondi41 ↔ 101PROSITE-ProRule annotation
Glycosylationi100 – 1001N-linked (GlcNAc...)Sequence Analysis
Glycosylationi113 – 1131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi160 – 1601N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi163 ↔ 212PROSITE-ProRule annotation
Glycosylationi209 – 2091N-linked (GlcNAc...)Sequence Analysis
Glycosylationi230 – 2301N-linked (GlcNAc...)Sequence Analysis
Modified residuei340 – 3401Phosphotyrosine2 Publications
Modified residuei358 – 3581Phosphotyrosine2 Publications

Post-translational modificationi

Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP20138.
PRIDEiP20138.

PTM databases

PhosphoSiteiP20138.

Expressioni

Tissue specificityi

Monocytic/myeloid lineage cells.

Gene expression databases

BgeeiP20138.
CleanExiHS_CD33.
ExpressionAtlasiP20138. baseline and differential.
GenevestigatoriP20138.

Organism-specific databases

HPAiCAB011442.
HPA035832.

Interactioni

Subunit structurei

Interacts with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPN11Q061245EBI-3906571,EBI-297779
PTPN6P293508EBI-3906571,EBI-78260

Protein-protein interaction databases

BioGridi107383. 9 interactions.
IntActiP20138. 3 interactions.
MINTiMINT-8020077.
STRINGi9606.ENSP00000262262.

Structurei

3D structure databases

ProteinModelPortaliP20138.
SMRiP20138. Positions 20-232.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini19 – 135117Ig-like V-typeAdd
BLAST
Domaini145 – 22884Ig-like C2-typeAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi338 – 3436ITIM motif 1
Motifi356 – 3616ITIM motif 2

Domaini

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG320441.
GeneTreeiENSGT00760000119139.
HOGENOMiHOG000236324.
HOVERGENiHBG036161.
InParanoidiP20138.
KOiK06473.
OMAiDEELHYA.
OrthoDBiEOG73JKV5.
PhylomeDBiP20138.
TreeFamiTF332441.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P20138-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLLLLLPLL WAGALAMDPN FWLQVQESVT VQEGLCVLVP CTFFHPIPYY
60 70 80 90 100
DKNSPVHGYW FREGAIISRD SPVATNKLDQ EVQEETQGRF RLLGDPSRNN
110 120 130 140 150
CSLSIVDARR RDNGSYFFRM ERGSTKYSYK SPQLSVHVTD LTHRPKILIP
160 170 180 190 200
GTLEPGHSKN LTCSVSWACE QGTPPIFSWL SAAPTSLGPR TTHSSVLIIT
210 220 230 240 250
PRPQDHGTNL TCQVKFAGAG VTTERTIQLN VTYVPQNPTT GIFPGDGSGK
260 270 280 290 300
QETRAGVVHG AIGGAGVTAL LALCLCLIFF IVKTHRRKAA RTAVGRNDTH
310 320 330 340 350
PTTGSASPKH QKKSKLHGPT ETSSCSGAAP TVEMDEELHY ASLNFHGMNP
360
SKDTSTEYSE VRTQ
Length:364
Mass (Da):39,825
Last modified:October 17, 2006 - v2
Checksum:i1C73E588240FBAD8
GO
Isoform 2 (identifier: P20138-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-364: KHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ → VR

Note: No experimental confirmation available.

Show »
Length:310
Mass (Da):33,890
Checksum:iF3618D0661DBE51E
GO
Isoform 3 (identifier: P20138-3) [UniParc]FASTAAdd to Basket

Also known as: CD33-m

The sequence of this isoform differs from the canonical sequence as follows:
     13-139: Missing.

Note: Mostly detected on NKL and myeloid cell lines but poorly expressed on B-cell lines and T-lymphocytes.

Show »
Length:237
Mass (Da):25,293
Checksum:i52C8CF965ACC740C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141A → V.1 Publication
Corresponds to variant rs12459419 [ dbSNP | Ensembl ].
VAR_049904
Natural varianti22 – 221W → R.
Corresponds to variant rs35814802 [ dbSNP | Ensembl ].
VAR_049905
Natural varianti69 – 691R → G.2 Publications
Corresponds to variant rs2455069 [ dbSNP | Ensembl ].
VAR_028260
Natural varianti128 – 1281S → N.
Corresponds to variant rs34919259 [ dbSNP | Ensembl ].
VAR_049906
Natural varianti202 – 2021R → W.
Corresponds to variant rs4082929 [ dbSNP | Ensembl ].
VAR_028261
Natural varianti242 – 2421I → L.
Corresponds to variant rs988337 [ dbSNP | Ensembl ].
VAR_028262
Natural varianti243 – 2431F → L.
Corresponds to variant rs11882250 [ dbSNP | Ensembl ].
VAR_028263
Natural varianti267 – 2671V → I.
Corresponds to variant rs58981829 [ dbSNP | Ensembl ].
VAR_061319
Natural varianti294 – 2941V → L.
Corresponds to variant rs2271652 [ dbSNP | Ensembl ].
VAR_028264
Natural varianti304 – 3041G → R.1 Publication
Corresponds to variant rs35112940 [ dbSNP | Ensembl ].
VAR_049907
Natural varianti331 – 3311T → A.
Corresponds to variant rs35632246 [ dbSNP | Ensembl ].
VAR_049908

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei13 – 139127Missing in isoform 3. 1 PublicationVSP_046172Add
BLAST
Alternative sequencei309 – 36456KHQKK…EVRTQ → VR in isoform 2. 1 PublicationVSP_045364Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M23197 mRNA. Translation: AAA51948.1. Sequence problems.
AY040541 Genomic DNA. Translation: AAK83654.1.
AY162464 mRNA. No translation available.
AK304810 mRNA. Translation: BAG65560.1.
AC063977 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71996.1.
BC028152 mRNA. Translation: AAH28152.1.
CCDSiCCDS33084.1. [P20138-1]
CCDS46157.1. [P20138-3]
CCDS54299.1. [P20138-2]
PIRiA30521.
RefSeqiNP_001076087.1. NM_001082618.1. [P20138-3]
NP_001171079.1. NM_001177608.1. [P20138-2]
NP_001763.3. NM_001772.3. [P20138-1]
UniGeneiHs.83731.

Genome annotation databases

EnsembliENST00000262262; ENSP00000262262; ENSG00000105383. [P20138-1]
ENST00000391796; ENSP00000375673; ENSG00000105383. [P20138-2]
ENST00000421133; ENSP00000410126; ENSG00000105383. [P20138-3]
GeneIDi945.
KEGGihsa:945.
UCSCiuc002pwa.2. human. [P20138-1]
uc010eot.1. human.

Polymorphism databases

DMDMi116241290.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Siglec-3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M23197 mRNA. Translation: AAA51948.1 . Sequence problems.
AY040541 Genomic DNA. Translation: AAK83654.1 .
AY162464 mRNA. No translation available.
AK304810 mRNA. Translation: BAG65560.1 .
AC063977 Genomic DNA. No translation available.
CH471135 Genomic DNA. Translation: EAW71996.1 .
BC028152 mRNA. Translation: AAH28152.1 .
CCDSi CCDS33084.1. [P20138-1 ]
CCDS46157.1. [P20138-3 ]
CCDS54299.1. [P20138-2 ]
PIRi A30521.
RefSeqi NP_001076087.1. NM_001082618.1. [P20138-3 ]
NP_001171079.1. NM_001177608.1. [P20138-2 ]
NP_001763.3. NM_001772.3. [P20138-1 ]
UniGenei Hs.83731.

3D structure databases

ProteinModelPortali P20138.
SMRi P20138. Positions 20-232.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107383. 9 interactions.
IntActi P20138. 3 interactions.
MINTi MINT-8020077.
STRINGi 9606.ENSP00000262262.

Chemistry

ChEMBLi CHEMBL1842.
DrugBanki DB00056. Gemtuzumab ozogamicin.
GuidetoPHARMACOLOGYi 2601.

PTM databases

PhosphoSitei P20138.

Polymorphism databases

DMDMi 116241290.

Proteomic databases

PaxDbi P20138.
PRIDEi P20138.

Protocols and materials databases

DNASUi 945.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262262 ; ENSP00000262262 ; ENSG00000105383 . [P20138-1 ]
ENST00000391796 ; ENSP00000375673 ; ENSG00000105383 . [P20138-2 ]
ENST00000421133 ; ENSP00000410126 ; ENSG00000105383 . [P20138-3 ]
GeneIDi 945.
KEGGi hsa:945.
UCSCi uc002pwa.2. human. [P20138-1 ]
uc010eot.1. human.

Organism-specific databases

CTDi 945.
GeneCardsi GC19P051729.
H-InvDB HIX0015379.
HGNCi HGNC:1659. CD33.
HPAi CAB011442.
HPA035832.
MIMi 159590. gene.
neXtProti NX_P20138.
PharmGKBi PA26210.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG320441.
GeneTreei ENSGT00760000119139.
HOGENOMi HOG000236324.
HOVERGENi HBG036161.
InParanoidi P20138.
KOi K06473.
OMAi DEELHYA.
OrthoDBi EOG73JKV5.
PhylomeDBi P20138.
TreeFami TF332441.

Miscellaneous databases

ChiTaRSi CD33. human.
GenomeRNAii 945.
NextBioi 3918.
PROi P20138.
SOURCEi Search...

Gene expression databases

Bgeei P20138.
CleanExi HS_CD33.
ExpressionAtlasi P20138. baseline and differential.
Genevestigatori P20138.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view ]
Pfami PF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 2 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of a cDNA encoding CD33, a differentiation antigen of myeloid progenitor cells."
    Simmons D., Seed B.
    J. Immunol. 141:2797-2800(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-69.
    Tissue: Premonocytic lymphoma.
  2. "Genomic organization of the siglec gene locus on chromosome 19q13.4 and cloning of two new siglec pseudogenes."
    Yousef G.M., Ordon M.H., Foussias G., Diamandis E.P.
    Gene 286:259-270(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing."
    Hernandez-Caselles T., Martinez-Esparza M., Perez-Oliva A.B., Quintanilla-Cecconi A.M., Garcia-Alonso A., Alvarez-Lopez D.M., Garcia-Penarrubia P.
    J. Leukoc. Biol. 79:46-58(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS VAL-14 AND ARG-304.
    Tissue: Uterus.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-69.
    Tissue: Leukocyte.
  8. "Characterization of CD33 as a new member of the sialoadhesin family of cellular interaction molecules."
    Freeman S.D., Kelm S., Barber E.K., Crocker P.R.
    Blood 85:2005-2012(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: SIALIC ACID-BINDING.
  9. "The sialoadhesin CD33 is a myeloid-specific inhibitory receptor."
    Ulyanova T., Blasioli J., Woodford-Thomas T.A., Thomas M.L.
    Eur. J. Immunol. 29:3440-3449(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION AT TYR-340 AND TYR-358, MUTAGENESIS OF TYR-358, INTERACTION WITH PTPN6.
  10. "The myeloid-specific sialic acid-binding receptor, CD33, associates with the protein-tyrosine phosphatases, SHP-1 and SHP-2."
    Taylor V.C., Buckley C.D., Douglas M., Cody A.J., Simmons D.L., Freeman S.D.
    J. Biol. Chem. 274:11505-11512(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT TYR-340 AND TYR-358, INTERACTION WITH PTPN6 AND PTPN11, MUTAGENESIS OF TYR-340.
  11. "Surface expression and function of p75/AIRM-1 or CD33 in acute myeloid leukemias: engagement of CD33 induces apoptosis of leukemic cells."
    Vitale C., Romagnani C., Puccetti A., Olive D., Costello R., Chiossone L., Pitto A., Bacigalupo A., Moretta L., Mingari M.C.
    Proc. Natl. Acad. Sci. U.S.A. 98:5764-5769(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiCD33_HUMAN
AccessioniPrimary (citable) accession number: P20138
Secondary accession number(s): B4E3P8
, C9JEN7, F8WAL2, Q8TD24
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: October 17, 2006
Last modified: October 29, 2014
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3