P20138 (CD33_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 143.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myeloid cell surface antigen CD33 Alternative name(s): Sialic acid-binding Ig-like lectin 3 Short name=Siglec-3 gp67 CD_antigen=CD33 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 364 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Ref.9 Ref.11 |
| Subunit structure | Interacts with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. Ref.9 Ref.10 |
| Subcellular location | |
| Tissue specificity | Monocytic/myeloid lineage cells. |
| Domain | Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. |
| Post-translational modification | Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6. |
| Sequence similarities | Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Ligand | Lectin |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Non-traceable author statement PubMed 10611343. Source: ProtInc cell-cell signalingTraceable author statement PubMed 10611343. Source: ProtInc negative regulation of cell proliferationTraceable author statement PubMed 10611343. Source: ProtInc signal transductionTraceable author statement PubMed 10611343. Source: ProtInc |
| Cellular_component | external side of plasma membrane Inferred from direct assay PubMed 20660734. Source: MGI integral to plasma membraneTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | receptor activity Traceable author statement PubMed 10611343. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P20138-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P20138-2) The sequence of this isoform differs from the canonical sequence as follows: 309-364: KHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ → VR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P20138-3) Also known as: CD33-m; The sequence of this isoform differs from the canonical sequence as follows: 13-139: Missing. | ||||||
| Note: Mostly detected on NKL and myeloid cell lines but poorly expressed on B cell lines and T lymphocytes. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 17 | 17 | Potential | ||||||||
| Chain | 18 – 364 | 347 | Myeloid cell surface antigen CD33 | PRO_0000014878 | |||||||
Regions | |||||||||||
| Topological domain | 18 – 259 | 242 | Extracellular Potential | ||||||||
| Transmembrane | 260 – 282 | 23 | Helical; Potential | ||||||||
| Topological domain | 283 – 364 | 82 | Cytoplasmic Potential | ||||||||
| Domain | 19 – 135 | 117 | Ig-like V-type | ||||||||
| Domain | 145 – 228 | 84 | Ig-like C2-type | ||||||||
| Motif | 338 – 343 | 6 | ITIM motif 1 | ||||||||
| Motif | 356 – 361 | 6 | ITIM motif 2 | ||||||||
Sites | |||||||||||
| Binding site | 119 | 1 | Sialic acid By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 340 | 1 | Phosphotyrosine Ref.9 Ref.10 | ||||||||
| Modified residue | 358 | 1 | Phosphotyrosine Ref.9 Ref.10 | ||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 113 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 160 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 230 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 36 ↔ 169 | By similarity | |||||||||
| Disulfide bond | 41 ↔ 101 | By similarity | |||||||||
| Disulfide bond | 163 ↔ 212 | Potential | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 13 – 139 | 127 | Missing in isoform 3. | VSP_046172 | |||||||
| Alternative sequence | 309 – 364 | 56 | KHQKK…EVRTQ → VR in isoform 2. | VSP_045364 | |||||||
| Natural variant | 14 | 1 | A → V. Ref.4 Corresponds to variant rs12459419 [ dbSNP | Ensembl ]. | VAR_049904 | |||||||
| Natural variant | 22 | 1 | W → R. Corresponds to variant rs35814802 [ dbSNP | Ensembl ]. | VAR_049905 | |||||||
| Natural variant | 69 | 1 | R → G. Ref.1 Ref.7 Corresponds to variant rs2455069 [ dbSNP | Ensembl ]. | VAR_028260 | |||||||
| Natural variant | 128 | 1 | S → N. Corresponds to variant rs34919259 [ dbSNP | Ensembl ]. | VAR_049906 | |||||||
| Natural variant | 202 | 1 | R → W. Corresponds to variant rs4082929 [ dbSNP | Ensembl ]. | VAR_028261 | |||||||
| Natural variant | 242 | 1 | I → L. Corresponds to variant rs988337 [ dbSNP | Ensembl ]. | VAR_028262 | |||||||
| Natural variant | 243 | 1 | F → L. Corresponds to variant rs11882250 [ dbSNP | Ensembl ]. | VAR_028263 | |||||||
| Natural variant | 267 | 1 | V → I. Corresponds to variant rs58981829 [ dbSNP | Ensembl ]. | VAR_061319 | |||||||
| Natural variant | 294 | 1 | V → L. Corresponds to variant rs2271652 [ dbSNP | Ensembl ]. | VAR_028264 | |||||||
| Natural variant | 304 | 1 | G → R. Ref.4 Corresponds to variant rs35112940 [ dbSNP | Ensembl ]. | VAR_049907 | |||||||
| Natural variant | 331 | 1 | T → A. Corresponds to variant rs35632246 [ dbSNP | Ensembl ]. | VAR_049908 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 340 | 1 | Y → A: Abolishes binding to PTPN6 and PTPN11. Increases binding of red blood cells. Ref.10 | ||||||||
| Mutagenesis | 358 | 1 | Y → A or F: Reduces binding to PTPN6. Ref.9 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of a cDNA encoding CD33, a differentiation antigen of myeloid progenitor cells." Simmons D., Seed B. J. Immunol. 141:2797-2800(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT GLY-69. Tissue: Premonocytic lymphoma. |
| [2] | "Genomic organization of the siglec gene locus on chromosome 19q13.4 and cloning of two new siglec pseudogenes." Yousef G.M., Ordon M.H., Foussias G., Diamandis E.P. Gene 286:259-270(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing." Hernandez-Caselles T., Martinez-Esparza M., Perez-Oliva A.B., Quintanilla-Cecconi A.M., Garcia-Alonso A., Alvarez-Lopez D.M., Garcia-Penarrubia P. J. Leukoc. Biol. 79:46-58(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS VAL-14 AND ARG-304. Tissue: Uterus. |
| [5] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-69. Tissue: Leukocyte. |
| [8] | "Characterization of CD33 as a new member of the sialoadhesin family of cellular interaction molecules." Freeman S.D., Kelm S., Barber E.K., Crocker P.R. Blood 85:2005-2012(1995) [PubMed] [Europe PMC] [Abstract] Cited for: SIALIC ACID-BINDING. |
| [9] | "The sialoadhesin CD33 is a myeloid-specific inhibitory receptor." Ulyanova T., Blasioli J., Woodford-Thomas T.A., Thomas M.L. Eur. J. Immunol. 29:3440-3449(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT TYR-340 AND TYR-358, MUTAGENESIS OF TYR-358, INTERACTION WITH PTPN6. |
| [10] | "The myeloid-specific sialic acid-binding receptor, CD33, associates with the protein-tyrosine phosphatases, SHP-1 and SHP-2." Taylor V.C., Buckley C.D., Douglas M., Cody A.J., Simmons D.L., Freeman S.D. J. Biol. Chem. 274:11505-11512(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-340 AND TYR-358, INTERACTION WITH PTPN6 AND PTPN11, MUTAGENESIS OF TYR-340. |
| [11] | "Surface expression and function of p75/AIRM-1 or CD33 in acute myeloid leukemias: engagement of CD33 induces apoptosis of leukemic cells." Vitale C., Romagnani C., Puccetti A., Olive D., Costello R., Chiossone L., Pitto A., Bacigalupo A., Moretta L., Mingari M.C. Proc. Natl. Acad. Sci. U.S.A. 98:5764-5769(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M23197 mRNA. Translation: AAA51948.1. Sequence problems. AY040541 Genomic DNA. Translation: AAK83654.1. AY162464 mRNA. No translation available. AK304810 mRNA. Translation: BAG65560.1. AC063977 Genomic DNA. No translation available. CH471135 Genomic DNA. Translation: EAW71996.1. BC028152 mRNA. Translation: AAH28152.1. |
| IPI | IPI00022203. IPI00844575. IPI00964702. |
| PIR | A30521. |
| RefSeq | NP_001076087.1. NM_001082618.1. NP_001171079.1. NM_001177608.1. NP_001763.3. NM_001772.3. |
| UniGene | Hs.83731. |
3D structure databases | |
| ProteinModelPortal | P20138. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P20138. 1 interaction. |
| MINT | MINT-8020077. |
| STRING | 9606.ENSP00000262262. |
PTM databases | |
| PhosphoSite | P20138. |
Polymorphism databases | |
| DMDM | 116241290. |
Proteomic databases | |
| PaxDb | P20138. |
| PRIDE | P20138. |
Protocols and materials databases | |
| DNASU | 945. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262262; ENSP00000262262; ENSG00000105383. ENST00000391796; ENSP00000375673; ENSG00000105383. ENST00000421133; ENSP00000410126; ENSG00000105383. |
| GeneID | 945. |
| KEGG | hsa:945. |
| UCSC | uc002pwa.2. human. uc010eos.1. human. uc010eot.1. human. |
Organism-specific databases | |
| CTD | 945. |
| GeneCards | GC19P051729. |
| H-InvDB | HIX0015379. |
| HGNC | HGNC:1659. CD33. |
| HPA | CAB011442. |
| MIM | 159590. gene. |
| neXtProt | NX_P20138. |
| PharmGKB | PA26210. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG320441. |
| HOGENOM | HOG000236324. |
| HOVERGEN | HBG036161. |
| InParanoid | P20138. |
| KO | K06473. |
| OMA | QKKSKLH. |
| OrthoDB | EOG43BMP7. |
| PhylomeDB | P20138. |
Gene expression databases | |
| ArrayExpress | P20138. |
| Bgee | P20138. |
| CleanEx | HS_CD33. |
| Genevestigator | P20138. |
| GermOnline | ENSG00000105383. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. IPR013151. Immunoglobulin. [Graphical view] |
| Pfam | PF00047. ig. 1 hit. PF07686. V-set. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 2 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL1842. |
| ChiTaRS | CD33. human. |
| DrugBank | DB00056. Gemtuzumab ozogamicin. |
| GenomeRNAi | 945. |
| NextBio | 3918. |
| SOURCE | Search... |
Entry information
| Entry name | CD33_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P20138 Secondary accession number(s): B4E3P8 Q8TD24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
