Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA-binding protein inhibitor ID-1

Gene

Id1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.2 Publications

GO - Molecular functioni

  • protein self-association Source: MGI
  • transcription factor activity, sequence-specific DNA binding Source: UniProtKB

GO - Biological processi

  • BMP signaling pathway Source: MGI
  • brain development Source: Ensembl
  • cell-abiotic substrate adhesion Source: Ensembl
  • cellular response to dopamine Source: Ensembl
  • cellular response to epidermal growth factor stimulus Source: Ensembl
  • cellular response to nerve growth factor stimulus Source: Ensembl
  • cellular response to peptide Source: Ensembl
  • cellular response to transforming growth factor beta stimulus Source: Ensembl
  • circadian rhythm Source: UniProtKB
  • collagen metabolic process Source: MGI
  • endothelial cell morphogenesis Source: MGI
  • heart development Source: MGI
  • lung morphogenesis Source: MGI
  • lung vasculature development Source: MGI
  • negative regulation of apoptotic process Source: MGI
  • negative regulation of dendrite morphogenesis Source: Ensembl
  • negative regulation of DNA binding Source: MGI
  • negative regulation of endothelial cell differentiation Source: Ensembl
  • negative regulation of gene expression Source: MGI
  • negative regulation of osteoblast differentiation Source: MGI
  • negative regulation of protein homodimerization activity Source: MGI
  • negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding Source: Ensembl
  • negative regulation of sequence-specific DNA binding transcription factor activity Source: MGI
  • negative regulation of transcription, DNA-templated Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • neuron differentiation Source: Ensembl
  • positive regulation of actin filament bundle assembly Source: Ensembl
  • positive regulation of epithelial cell proliferation Source: Ensembl
  • positive regulation of gene expression Source: Ensembl
  • protein destabilization Source: MGI
  • regulation of angiogenesis Source: MGI
  • regulation of MAPK cascade Source: MGI
  • response to antibiotic Source: MGI
  • transcription, DNA-templated Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Biological rhythms, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-2559585. Oncogene Induced Senescence.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA-binding protein inhibitor ID-1
Alternative name(s):
Inhibitor of DNA binding 1
Inhibitor of differentiation 1
Gene namesi
Name:Id1
Synonyms:Id, Id-1, Idb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:96396. Id1.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus PROSITE-ProRule annotation1 Publication

GO - Cellular componenti

  • centrosome Source: Ensembl
  • cytoplasm Source: MGI
  • Golgi apparatus Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 168168DNA-binding protein inhibitor ID-1PRO_0000127237Add
BLAST

Post-translational modificationi

Polyubiquitinated; which is favored by Ifi204 and leads to proteasomal degradation.By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiP20067.
PaxDbiP20067.
PRIDEiP20067.

PTM databases

iPTMnetiP20067.
PhosphoSiteiP20067.

Expressioni

Inductioni

Expressed in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain and heart with peak levels seen between CT16 and CT20 in the SCN and between CT8 and CT12 in the heart.1 Publication

Gene expression databases

BgeeiP20067.
CleanExiMM_ID1.
ExpressionAtlasiP20067. baseline and differential.
GenevisibleiP20067. MM.

Interactioni

Subunit structurei

Heterodimer with other HLH proteins. Interacts with CLOCK and ARNTL/BMAL1 (By similarity). Interacts with COPS5, IFI204, GATA4 and NKX2-5.By similarity3 Publications

GO - Molecular functioni

  • protein self-association Source: MGI

Protein-protein interaction databases

IntActiP20067. 3 interactions.
MINTiMINT-217824.
STRINGi10090.ENSMUSP00000092019.

Structurei

3D structure databases

ProteinModelPortaliP20067.
SMRiP20067. Positions 58-104.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini46 – 9853bHLHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni53 – 10654Interaction with IFI204By similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi91 – 10414Nuclear export signalAdd
BLAST

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IWDR. Eukaryota.
ENOG4111VAY. LUCA.
HOGENOMiHOG000234788.
HOVERGENiHBG009009.
InParanoidiP20067.
OrthoDBiEOG7X9G8G.
PhylomeDBiP20067.
TreeFamiTF326217.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR026052. DNA-bd_prot-inh.
[Graphical view]
PANTHERiPTHR11723. PTHR11723. 1 hit.
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform Long (identifier: P20067-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVASGSAAA AAGPSCSLKA GRTAGEVVLG LSEQSVAISR CAGTRLPALL
60 70 80 90 100
DEQQVNVLLY DMNGCYSRLK ELVPTLPQNR KVSKVEILQH VIDYIRDLQL
110 120 130 140 150
ELNSESEVGT TGGRGLPVRA PLSTLNGEIS ALAAEVRSES EYYIILQWET
160
EATGGGCPPS LLFRRIAI
Length:168
Mass (Da):17,914
Last modified:November 1, 1997 - v3
Checksum:i7F7EF0177358F516
GO
Isoform Short (identifier: P20067-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-168: VRSESEYYIILQWETEATGGGCPPSLLFRRIAI → AACVPADDRILCR

Show »
Length:148
Mass (Da):15,560
Checksum:iE12DAC2DA361E3B2
GO

Sequence cautioni

The sequence AAA37879.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti140 – 1401S → A in BAB25564 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei136 – 16833VRSES…RRIAI → AACVPADDRILCR in isoform Short. 1 PublicationVSP_002109Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31885 mRNA. Translation: AAA37879.1. Different initiation.
U43884 mRNA. Translation: AAC52760.1.
AK008264 mRNA. Translation: BAB25564.1.
CCDSiCCDS16897.1. [P20067-2]
PIRiA34690.
S72171.
UniGeneiMm.444.

Genome annotation databases

EnsembliENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745. [P20067-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31885 mRNA. Translation: AAA37879.1. Different initiation.
U43884 mRNA. Translation: AAC52760.1.
AK008264 mRNA. Translation: BAB25564.1.
CCDSiCCDS16897.1. [P20067-2]
PIRiA34690.
S72171.
UniGeneiMm.444.

3D structure databases

ProteinModelPortaliP20067.
SMRiP20067. Positions 58-104.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP20067. 3 interactions.
MINTiMINT-217824.
STRINGi10090.ENSMUSP00000092019.

PTM databases

iPTMnetiP20067.
PhosphoSiteiP20067.

Proteomic databases

MaxQBiP20067.
PaxDbiP20067.
PRIDEiP20067.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000038368; ENSMUSP00000092019; ENSMUSG00000042745. [P20067-2]

Organism-specific databases

MGIiMGI:96396. Id1.

Phylogenomic databases

eggNOGiENOG410IWDR. Eukaryota.
ENOG4111VAY. LUCA.
HOGENOMiHOG000234788.
HOVERGENiHBG009009.
InParanoidiP20067.
OrthoDBiEOG7X9G8G.
PhylomeDBiP20067.
TreeFamiTF326217.

Enzyme and pathway databases

ReactomeiR-MMU-2559585. Oncogene Induced Senescence.

Miscellaneous databases

PROiP20067.
SOURCEiSearch...

Gene expression databases

BgeeiP20067.
CleanExiMM_ID1.
ExpressionAtlasiP20067. baseline and differential.
GenevisibleiP20067. MM.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
IPR026052. DNA-bd_prot-inh.
[Graphical view]
PANTHERiPTHR11723. PTHR11723. 1 hit.
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The protein Id: a negative regulator of helix-loop-helix DNA binding proteins."
    Benezra R., Davis R.L., Lockshon D., Turner D.L., Weintraub H.
    Cell 61:49-59(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
  2. "Molecular cloning of the cDNA encoding a helix-loop-helix protein, mouse ID1B: tissue-specific expression of ID1A and ID1B genes."
    Hernandez M.-C., Andres-Barquin P.J., Israel M.A.
    Biochim. Biophys. Acta 1308:28-30(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
    Strain: Swiss albino.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
    Strain: C57BL/6J.
    Tissue: Small intestine.
  4. "The MyoD-inducible p204 protein overcomes the inhibition of myoblast differentiation by Id proteins."
    Liu C.-J., Ding B., Wang H., Lengyel P.
    Mol. Cell. Biol. 22:2893-2905(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH IFI204.
  5. "Ubiquitin-dependent degradation of Id1 and Id3 is mediated by the COP9 signalosome."
    Berse M., Bounpheng M., Huang X., Christy B., Pollmann C., Dubiel W.
    J. Mol. Biol. 343:361-370(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH COPS5.
  6. "Identification of the nuclear export signal in the helix-loop-helix inhibitor Id1."
    Makita J., Kurooka H., Mori K., Akagi Y., Yokota Y.
    FEBS Lett. 580:1812-1816(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, NUCLEAR EXPORT SIGNAL.
  7. "p204 protein overcomes the inhibition of the differentiation of P19 murine embryonal carcinoma cells to beating cardiac myocytes by Id proteins."
    Ding B., Liu C.-J., Huang Y., Yu J., Kong W., Lengyel P.
    J. Biol. Chem. 281:14893-14906(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH GATA4 AND NKX2-5.
  8. "A role for Id2 in regulating photic entrainment of the mammalian circadian system."
    Duffield G.E., Watson N.P., Mantani A., Peirson S.N., Robles-Murguia M., Loros J.J., Israel M.A., Dunlap J.C.
    Curr. Biol. 19:297-304(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INDUCTION.

Entry informationi

Entry nameiID1_MOUSE
AccessioniPrimary (citable) accession number: P20067
Secondary accession number(s): Q61101, Q9D897
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: November 1, 1997
Last modified: June 8, 2016
This is version 151 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.