Reviewed,
UniProtKB/Swiss-Prot P20023 (CR2_HUMAN)
Last modified
November 24, 2009.
Version 108.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Complement receptor type 2 Short name=Cr2 Alternative name(s): Complement C3d receptor Epstein-Barr virus receptor Short name=EBV receptor CD_antigen=CD21 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1033 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRPU. Participates in B lymphocytes activation. Ref.9 |
| Subcellular location | |
| Tissue specificity | Mature B-lymphocytes, T-lymphocytes, pharyngeal epithelial cells, astrocytes and follicular dendritic cells of the spleen. |
| Involvement in disease | Genetic variations in CR2 are associated with susceptibility to systemic lupus erythematosus type 9 (SLEB9) [MIM:610927]. Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a complex genetic basis. SLE is an inflammatory, and often febrile multisystemic disorder of connective tissue characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Ref.14 |
| Sequence similarities | Belongs to the receptors of complement activation (RCA) family. Contains 15 Sushi (CCP/SCR) domains. |
| Sequence caution | The sequence AAA35784.1 differs from that shown. Reason: Frameshift at positions 758, 769 and 776. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Complement pathway Immune response Innate immunity |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Systemic lupus erythematosus |
| Domain | Repeat Signal Sushi Transmembrane |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | complement activation, classical pathway Inferred from electronic annotation. Source: UniProtKB-KW innate immune responseInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | integral to membrane Ref.3 Non-traceable author statement. Source: UniProtKB plasma membrane Ref.1Non-traceable author statement. Source: ProtInc |
| Molecular function | complement receptor activity Ref.1 Ref.3 Non-traceable author statement. Source: UniProtKB protein homodimerization activityInferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P20023-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P20023-2) The sequence of this isoform differs from the canonical sequence as follows: 499-524: Missing. 525-556: ITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTC → NHLPTTPCYLQWGTHREFLRRFSIWNHGHLHM | ||||||
| Isoform C (identifier: P20023-3) The sequence of this isoform differs from the canonical sequence as follows: 659-659: K → KGCQPPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE | ||||||
| Isoform D (identifier: P20023-4) The sequence of this isoform differs from the canonical sequence as follows: 659-659: K → KGCQPPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE 716-723: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | |||||||||||||||||||||||||||||||||
| Chain | 21 – 1033 | 1013 | Complement receptor type 2 | PRO_0000006010 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Topological domain | 21 – 971 | 951 | Extracellular Potential | ||||||||||||||||||||||||||||||||
| Transmembrane | 972 – 999 | 28 | Potential | ||||||||||||||||||||||||||||||||
| Topological domain | 1000 – 1033 | 34 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||
| Domain | 21 – 84 | 64 | Sushi 1 | ||||||||||||||||||||||||||||||||
| Domain | 89 – 148 | 60 | Sushi 2 | ||||||||||||||||||||||||||||||||
| Domain | 152 – 212 | 61 | Sushi 3 | ||||||||||||||||||||||||||||||||
| Domain | 213 – 273 | 61 | Sushi 4 | ||||||||||||||||||||||||||||||||
| Domain | 274 – 344 | 71 | Sushi 5 | ||||||||||||||||||||||||||||||||
| Domain | 349 – 408 | 60 | Sushi 6 | ||||||||||||||||||||||||||||||||
| Domain | 409 – 468 | 60 | Sushi 7 | ||||||||||||||||||||||||||||||||
| Domain | 469 – 524 | 56 | Sushi 8 | ||||||||||||||||||||||||||||||||
| Domain | 525 – 595 | 71 | Sushi 9 | ||||||||||||||||||||||||||||||||
| Domain | 600 – 659 | 60 | Sushi 10 | ||||||||||||||||||||||||||||||||
| Domain | 660 – 716 | 57 | Sushi 11 | ||||||||||||||||||||||||||||||||
| Domain | 717 – 781 | 65 | Sushi 12 | ||||||||||||||||||||||||||||||||
| Domain | 786 – 845 | 60 | Sushi 13 | ||||||||||||||||||||||||||||||||
| Domain | 849 – 909 | 61 | Sushi 14 | ||||||||||||||||||||||||||||||||
| Domain | 910 – 970 | 61 | Sushi 15 | ||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||
| Modified residue | 1029 | 1 | Phosphotyrosine Ref.10 | ||||||||||||||||||||||||||||||||
| Glycosylation | 121 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||||||||||||||||||||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||||||||||||||||||||||||||
| Glycosylation | 294 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 372 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 492 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 623 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||||||||||||||||||||||||||
| Glycosylation | 682 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 800 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 823 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 861 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Glycosylation | 911 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||
| Disulfide bond | 23 ↔ 65 | Ref.13 Ref.12 | |||||||||||||||||||||||||||||||||
| Disulfide bond | 51 ↔ 82 | Ref.13 Ref.12 | |||||||||||||||||||||||||||||||||
| Disulfide bond | 91 ↔ 132 | Ref.13 Ref.12 | |||||||||||||||||||||||||||||||||
| Disulfide bond | 118 ↔ 146 | Ref.13 Ref.12 | |||||||||||||||||||||||||||||||||
| Disulfide bond | 154 ↔ 197 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 183 ↔ 210 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 215 ↔ 256 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 242 ↔ 271 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 276 ↔ 325 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 305 ↔ 342 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 351 ↔ 393 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 379 ↔ 406 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 410 ↔ 453 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 439 ↔ 466 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 471 ↔ 509 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 495 ↔ 522 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 527 ↔ 576 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 556 ↔ 593 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 602 ↔ 644 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 630 ↔ 657 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 662 ↔ 699 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 685 ↔ 714 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 719 ↔ 762 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 748 ↔ 779 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 788 ↔ 830 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 816 ↔ 843 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 851 ↔ 894 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 880 ↔ 907 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 912 ↔ 955 | By similarity | |||||||||||||||||||||||||||||||||
| Disulfide bond | 941 ↔ 968 | By similarity | |||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 499 – 524 | 26 | Missing in isoform B. | VSP_001208 | |||||||||||||||||||||||||||||||
| Alternative sequence | 525 – 556 | 32 | ITCPP…VTYTC → NHLPTTPCYLQWGTHREFLR RFSIWNHGHLHM in isoform B. | VSP_001209 | |||||||||||||||||||||||||||||||
| Alternative sequence | 659 | 1 | K → KGCQPPPGLHHGRHTGGNTV FFVSGMTVDYTCDPGYLLVG NKSIHCMPSGNWSPSAPRCE in isoform C and isoform D. | VSP_001210 | |||||||||||||||||||||||||||||||
| Alternative sequence | 716 – 723 | 8 | Missing in isoform D. | VSP_001211 | |||||||||||||||||||||||||||||||
| Natural variant | 639 | 1 | S → N: dbSNP rs17615. Ref.14 Ref.6 | VAR_016164 | |||||||||||||||||||||||||||||||
| Natural variant | 993 | 1 | I → V: dbSNP rs17258982. Ref.2 | VAR_016165 | |||||||||||||||||||||||||||||||
| Natural variant | 1003 | 1 | A → E: dbSNP rs6540433. Ref.1 Ref.3 | VAR_016166 | |||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 457 | 1 | Missing in CAA68674. Ref.2 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 646 | 1 | A → R in AAA35784. Ref.3 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 667 | 1 | Q → D AA sequence Ref.7 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 774 | 1 | G → E in AAA35784. Ref.3 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 783 – 787 | 5 | PPVTR → L in AAA35784. Ref.3 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 844 | 1 | I → M in AAA35786. Ref.1 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 844 | 1 | I → M in AAB04638. Ref.1 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 886 | 1 | L → V in AAA35784. Ref.3 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 890 | 1 | A → P in AAA35784. Ref.3 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 902 | 1 | Q → G AA sequence Ref.7 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 906 | 1 | H → L AA sequence Ref.7 | ||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 32 – 34 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 39 – 42 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 46 – 51 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 55 – 59 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 61 – 66 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 68 – 72 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 74 – 77 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 81 – 84 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 99 – 103 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 113 – 118 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 123 – 126 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 128 – 132 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 145 – 147 | 3 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic organization and polymorphisms of the human C3d/Epstein-Barr virus receptor." Fujisaku A., Harley J.B., Frank M.B., Gruner B.A., Frazier B., Holers V.M. J. Biol. Chem. 264:2118-2125(1989) [PubMed: 2563370] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], VARIANT GLU-1003. |
| [2] | "Structure of the human B lymphocyte receptor for C3d and the Epstein-Barr virus and relatedness to other members of the family of C3/C4 binding proteins." Weis J.J., Toothaker L.E., Smith J.A., Weis J.H., Fearon D.T. J. Exp. Med. 167:1047-1066(1988) [PubMed: 2832506] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT VAL-993. Tissue: B-cell. |
| [3] | "Molecular cloning of the cDNA encoding the Epstein-Barr virus.C3d receptor (complement receptor type 2) of human b lymphocytes." Moore M., Cooper N., Tack B., Nemerow G. Proc. Natl. Acad. Sci. U.S.A. 84:9194-9198(1987) [PubMed: 2827171] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT GLU-1003. |
| [4] | "Evidence for a new transcript of the Epstein-Barr virus/C3d receptor (CR2, CD21) which is due to alternative exon usage." Barel M., Balbo M., Frade R. Mol. Immunol. 35:1025-1031(1998) [PubMed: 10068037] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; C AND D). |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A), VARIANT ASN-639. Tissue: Lymph. |
| [7] | "Identification of a partial cDNA clone for the C3d/Epstein-Barr virus receptor of human B lymphocytes: homology with the receptor for fragments C3b and C4b of the third and fourth components of complement." Weis J.J., Fearon D.T., Klickstein L.B., Wong W.W., Richards S.A., de Bruyn Kops A., Smith J.A., Weis J.H. Proc. Natl. Acad. Sci. U.S.A. 83:5639-5643(1986) [PubMed: 3016712] [Abstract] Cited for: PROTEIN SEQUENCE OF 226-233; 256-267; 332-341; 667-677 AND 898-908. |
| [8] | "Characterization of the EBV/C3d receptor on the human Jurkat T cell line: evidence for a novel transcript." Sinha S.K., Todd S.C., Hedrick J.A., Speiser C.L., Lambris J.D., Tsoukas C.D. J. Immunol. 150:5311-5320(1993) [PubMed: 8390533] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 492-556 (ISOFORM B). |
| [9] | "Binding sites of the Epstein-Barr virus and C3d receptor (CR2, CD21) for its three intracellular ligands, the p53 anti-oncoprotein, the p68 calcium binding protein and the nuclear p120 ribonucleoprotein." Barel M., Balbo M., Gauffre A., Frade R. Mol. Immunol. 32:389-397(1995) [PubMed: 7753047] [Abstract] Cited for: FUNCTION AS A RECEPTOR FOR HNRPU. |
| [10] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1029, MASS SPECTROMETRY. |
| [11] | "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386(2009) [PubMed: 19349973] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-623, MASS SPECTROMETRY. |
| [12] | "Structure of complement receptor 2 in complex with its C3d ligand." Szakonyi G., Guthridge J.M., Li D., Young K., Holers V.M., Chen X.S. Science 292:1725-1728(2001) [PubMed: 11387479] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.04 ANGSTROMS) OF 21-153 IN COMPLEX WITH C3D, DISULFIDE BONDS. |
| [13] | "The crystal structure of human CD21: Implications for Epstein-Barr virus and C3d binding." Prota A.E., Sage D.R., Stehle T., Fingeroth J.D. Proc. Natl. Acad. Sci. U.S.A. 99:10641-10646(2002) [PubMed: 12122212] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 22-148, DISULFIDE BONDS, GLYCOSYLATION AT ASN-121 AND ASN-127. |
| [14] | "Association of a common complement receptor 2 haplotype with increased risk of systemic lupus erythematosus." Wu H., Boackle S.A., Hanvivadhanakul P., Ulgiati D., Grossman J.M., Lee Y., Shen N., Abraham L.J., Mercer T.R., Park E., Hebert L.A., Rovin B.H., Birmingham D.J., Chang D.-M., Chen C.J., McCurdy D., Badsha H.M., Thong B.Y.H. Tsao B.P.Proc. Natl. Acad. Sci. U.S.A. 104:3961-3966(2007) [PubMed: 17360460] [Abstract] Cited for: VARIANT ASN-639, INVOLVEMENT IN SLEB9. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M26004 mRNA. Translation: AAA35786.1. M26016 M26015 Genomic DNA. Translation: AAB04638.1. Y00649 mRNA. Translation: CAA68674.1. J03565 mRNA. Translation: AAA35784.1. Frameshift. AL391597, AL691452 Genomic DNA. Translation: CAH72949.1. AL691452, AL391597 Genomic DNA. Translation: CAI16730.1. BC090937 mRNA. Translation: AAH90937.1. S62696 mRNA. Translation: AAB27186.1. | |||||||||||||||||||||||||||||||||||||
| IPI | IPI00216985. IPI00216986. IPI00216987. IPI00292859. | ||||||||||||||||||||||||||||||||||||
| PIR | PL0009. JL0028. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001868.2. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.445757 | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| STRING | P20023. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P20023. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PRIDE | P20023. | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000367058; ENSP00000356025; ENSG00000117322; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||
| GeneID | 1380. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:1380. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 1380. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC01P205694. | ||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0028731. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:2336. CR2. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB002659. | ||||||||||||||||||||||||||||||||||||
| MIM | 120650. gene. 610927. phenotype. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 101994. Complement regulatory proteins anomaly. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA24743. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| HOVERGEN | P20023. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P20023. | ||||||||||||||||||||||||||||||||||||
| Bgee | P20023. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_CR2. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P20023. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000117322. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR016060. Complement_control_module. IPR000436. Sushi_SCR_CCP. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.10.70.10. Complement_control_module. 11 hits. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00084. Sushi. 13 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00032. CCP. 14 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50923. SUSHI. 15 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||
| NextBio | 5605. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P20023 Secondary accession number(s): Q13866 Q5SR48 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


