Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Complement receptor type 2

Gene

CR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRPU. Participates in B lymphocytes activation.1 Publication
(Microbial infection) Acts as a receptor for Epstein-Barr virus.1 Publication

GO - Molecular functioni

  • complement binding Source: UniProtKB
  • complement receptor activity Source: UniProtKB
  • DNA binding Source: UniProtKB
  • protein homodimerization activity Source: MGI
  • transmembrane signaling receptor activity Source: UniProtKB
  • virus receptor activity Source: UniProtKB-KW

GO - Biological processi

  • B cell differentiation Source: UniProtKB
  • B cell proliferation Source: UniProtKB
  • complement activation, classical pathway Source: UniProtKB-KW
  • immune response Source: UniProtKB
  • innate immune response Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Host cell receptor for virus entry, Receptor

Keywords - Biological processi

Complement pathway, Host-virus interaction, Immunity, Innate immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000117322-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Complement receptor type 2
Short name:
Cr2
Alternative name(s):
Complement C3d receptor
Epstein-Barr virus receptor
Short name:
EBV receptor
CD_antigen: CD21
Gene namesi
Name:CR2
Synonyms:C3DR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:2336. CR2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini21 – 971ExtracellularSequence analysisAdd BLAST951
Transmembranei972 – 999HelicalSequence analysisAdd BLAST28
Topological domaini1000 – 1033CytoplasmicSequence analysisAdd BLAST34

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: UniProtKB
  • plasma membrane Source: ProtInc
  • receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Systemic lupus erythematosus 9 (SLEB9)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow.
See also OMIM:610927
Immunodeficiency, common variable, 7 (CVID7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
See also OMIM:614699

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi103R → A: No effect on affinity for C3. 1 Publication1
Mutagenesisi112D → A: Reduced affinity for C3. 1 Publication1
Mutagenesisi128K → A: Strongly reduced affinity for C3. 1 Publication1

Keywords - Diseasei

Systemic lupus erythematosus

Organism-specific databases

DisGeNETi1380.
MalaCardsiCR2.
MIMi610927. phenotype.
614699. phenotype.
OpenTargetsiENSG00000117322.
Orphaneti1572. Common variable immunodeficiency.
536. Systemic lupus erythematosus.
PharmGKBiPA26857.

Polymorphism and mutation databases

BioMutaiCR2.
DMDMi215273962.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Add BLAST20
ChainiPRO_000000601021 – 1033Complement receptor type 2Add BLAST1013

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi23 ↔ 65
Disulfide bondi51 ↔ 82
Disulfide bondi91 ↔ 132
Disulfide bondi118 ↔ 146
Glycosylationi121N-linked (GlcNAc...)1 Publication1
Glycosylationi127N-linked (GlcNAc...)1 Publication1
Disulfide bondi154 ↔ 197PROSITE-ProRule annotation
Disulfide bondi183 ↔ 210PROSITE-ProRule annotation
Disulfide bondi215 ↔ 256PROSITE-ProRule annotation
Disulfide bondi242 ↔ 271PROSITE-ProRule annotation
Disulfide bondi276 ↔ 325PROSITE-ProRule annotation
Glycosylationi294N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi305 ↔ 342PROSITE-ProRule annotation
Disulfide bondi351 ↔ 393PROSITE-ProRule annotation
Glycosylationi372N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi379 ↔ 406PROSITE-ProRule annotation
Disulfide bondi410 ↔ 453PROSITE-ProRule annotation
Disulfide bondi439 ↔ 466PROSITE-ProRule annotation
Disulfide bondi471 ↔ 509PROSITE-ProRule annotation
Glycosylationi492N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi495 ↔ 522PROSITE-ProRule annotation
Disulfide bondi527 ↔ 576PROSITE-ProRule annotation
Disulfide bondi556 ↔ 593PROSITE-ProRule annotation
Disulfide bondi602 ↔ 644PROSITE-ProRule annotation
Glycosylationi623N-linked (GlcNAc...)1 Publication1
Disulfide bondi630 ↔ 657PROSITE-ProRule annotation
Disulfide bondi662 ↔ 699PROSITE-ProRule annotation
Glycosylationi682N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi685 ↔ 714PROSITE-ProRule annotation
Disulfide bondi719 ↔ 762PROSITE-ProRule annotation
Disulfide bondi748 ↔ 779PROSITE-ProRule annotation
Disulfide bondi788 ↔ 830PROSITE-ProRule annotation
Glycosylationi800N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi816 ↔ 843PROSITE-ProRule annotation
Glycosylationi823N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi851 ↔ 894PROSITE-ProRule annotation
Glycosylationi861N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi880 ↔ 907PROSITE-ProRule annotation
Glycosylationi911N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi912 ↔ 955PROSITE-ProRule annotation
Disulfide bondi941 ↔ 968PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlasiP20023.
PRIDEiP20023.

PTM databases

iPTMnetiP20023.
PhosphoSitePlusiP20023.

Expressioni

Tissue specificityi

Mature B-lymphocytes, T-lymphocytes, pharyngeal epithelial cells, astrocytes and follicular dendritic cells of the spleen.

Gene expression databases

BgeeiENSG00000117322.
CleanExiHS_CR2.
ExpressionAtlasiP20023. baseline and differential.
GenevisibleiP20023. HS.

Organism-specific databases

HPAiCAB002659.
HPA052942.
HPA060715.

Interactioni

Subunit structurei

Interacts (via Sushi domain 1 and 2) with C3dg.2 Publications
(Microbial infection) Interacts with Epstein-Barr virus gp350 protein.1 Publication

GO - Molecular functioni

  • complement binding Source: UniProtKB
  • protein homodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi107771. 7 interactors.
IntActiP20023. 1 interactor.
MINTiMINT-1508214.

Structurei

Secondary structure

11033
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi32 – 34Combined sources3
Beta strandi39 – 42Combined sources4
Beta strandi46 – 51Combined sources6
Beta strandi55 – 59Combined sources5
Beta strandi61 – 66Combined sources6
Beta strandi68 – 72Combined sources5
Beta strandi74 – 77Combined sources4
Beta strandi81 – 84Combined sources4
Beta strandi99 – 103Combined sources5
Beta strandi106 – 109Combined sources4
Beta strandi113 – 118Combined sources6
Beta strandi122 – 126Combined sources5
Beta strandi128 – 132Combined sources5
Beta strandi136 – 141Combined sources6
Beta strandi145 – 148Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GHQX-ray2.04B/C21-153[»]
1LY2X-ray1.80A22-148[»]
1W2RX-ray-A21-153[»]
1W2SX-ray-B21-153[»]
2GSXX-ray-A21-971[»]
3OEDX-ray3.16C/D20-153[»]
ProteinModelPortaliP20023.
SMRiP20023.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP20023.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 84Sushi 1PROSITE-ProRule annotationAdd BLAST64
Domaini89 – 148Sushi 2PROSITE-ProRule annotationAdd BLAST60
Domaini152 – 212Sushi 3PROSITE-ProRule annotationAdd BLAST61
Domaini213 – 273Sushi 4PROSITE-ProRule annotationAdd BLAST61
Domaini274 – 344Sushi 5PROSITE-ProRule annotationAdd BLAST71
Domaini349 – 408Sushi 6PROSITE-ProRule annotationAdd BLAST60
Domaini409 – 468Sushi 7PROSITE-ProRule annotationAdd BLAST60
Domaini469 – 524Sushi 8PROSITE-ProRule annotationAdd BLAST56
Domaini525 – 595Sushi 9PROSITE-ProRule annotationAdd BLAST71
Domaini600 – 659Sushi 10PROSITE-ProRule annotationAdd BLAST60
Domaini660 – 716Sushi 11PROSITE-ProRule annotationAdd BLAST57
Domaini717 – 781Sushi 12PROSITE-ProRule annotationAdd BLAST65
Domaini786 – 845Sushi 13PROSITE-ProRule annotationAdd BLAST60
Domaini849 – 909Sushi 14PROSITE-ProRule annotationAdd BLAST61
Domaini910 – 970Sushi 15PROSITE-ProRule annotationAdd BLAST61

Sequence similaritiesi

Contains 15 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118803.
HOGENOMiHOG000111964.
HOVERGENiHBG005399.
InParanoidiP20023.
KOiK04012.
OMAiTVIFACM.
OrthoDBiEOG091G0054.
PhylomeDBiP20023.
TreeFamiTF316872.

Family and domain databases

CDDicd00033. CCP. 13 hits.
InterProiIPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF00084. Sushi. 13 hits.
[Graphical view]
SMARTiSM00032. CCP. 14 hits.
[Graphical view]
SUPFAMiSSF57535. SSF57535. 15 hits.
PROSITEiPS50923. SUSHI. 15 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: P20023-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAAGLLGVF LALVAPGVLG ISCGSPPPIL NGRISYYSTP IAVGTVIRYS
60 70 80 90 100
CSGTFRLIGE KSLLCITKDK VDGTWDKPAP KCEYFNKYSS CPEPIVPGGY
110 120 130 140 150
KIRGSTPYRH GDSVTFACKT NFSMNGNKSV WCQANNMWGP TRLPTCVSVF
160 170 180 190 200
PLECPALPMI HNGHHTSENV GSIAPGLSVT YSCESGYLLV GEKIINCLSS
210 220 230 240 250
GKWSAVPPTC EEARCKSLGR FPNGKVKEPP ILRVGVTANF FCDEGYRLQG
260 270 280 290 300
PPSSRCVIAG QGVAWTKMPV CEEIFCPSPP PILNGRHIGN SLANVSYGSI
310 320 330 340 350
VTYTCDPDPE EGVNFILIGE STLRCTVDSQ KTGTWSGPAP RCELSTSAVQ
360 370 380 390 400
CPHPQILRGR MVSGQKDRYT YNDTVIFACM FGFTLKGSKQ IRCNAQGTWE
410 420 430 440 450
PSAPVCEKEC QAPPNILNGQ KEDRHMVRFD PGTSIKYSCN PGYVLVGEES
460 470 480 490 500
IQCTSEGVWT PPVPQCKVAA CEATGRQLLT KPQHQFVRPD VNSSCGEGYK
510 520 530 540 550
LSGSVYQECQ GTIPWFMEIR LCKEITCPPP PVIYNGAHTG SSLEDFPYGT
560 570 580 590 600
TVTYTCNPGP ERGVEFSLIG ESTIRCTSND QERGTWSGPA PLCKLSLLAV
610 620 630 640 650
QCSHVHIANG YKISGKEAPY FYNDTVTFKC YSGFTLKGSS QIRCKADNTW
660 670 680 690 700
DPEIPVCEKE TCQHVRQSLQ ELPAGSRVEL VNTSCQDGYQ LTGHAYQMCQ
710 720 730 740 750
DAENGIWFKK IPLCKVIHCH PPPVIVNGKH TGMMAENFLY GNEVSYECDQ
760 770 780 790 800
GFYLLGEKKL QCRSDSKGHG SWSGPSPQCL RSPPVTRCPN PEVKHGYKLN
810 820 830 840 850
KTHSAYSHND IVYVDCNPGF IMNGSRVIRC HTDNTWVPGV PTCIKKAFIG
860 870 880 890 900
CPPPPKTPNG NHTGGNIARF SPGMSILYSC DQGYLLVGEA LLLCTHEGTW
910 920 930 940 950
SQPAPHCKEV NCSSPADMDG IQKGLEPRKM YQYGAVVTLE CEDGYMLEGS
960 970 980 990 1000
PQSQCQSDHQ WNPPLAVCRS RSLAPVLCGI AAGLILLTFL IVITLYVISK
1010 1020 1030
HRARNYYTDT SQKEAFHLEA REVYSVDPYN PAS
Length:1,033
Mass (Da):112,916
Last modified:November 25, 2008 - v2
Checksum:i7D89DB4A07847E9A
GO
Isoform B (identifier: P20023-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     499-524: Missing.
     525-556: ITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTC → NHLPTTPCYLQWGTHREFLRRFSIWNHGHLHM

Show »
Length:1,007
Mass (Da):110,408
Checksum:iBA75D3B0A8EB5511
GO
Isoform C (identifier: P20023-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     659-659: K → KGCQSPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE

Show »
Length:1,092
Mass (Da):119,160
Checksum:iA52592EB53DE7374
GO
Isoform D (identifier: P20023-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     659-659: K → KGCQSPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCE
     716-723: Missing.

Show »
Length:1,084
Mass (Da):118,279
Checksum:i9C232F47D384E59B
GO

Sequence cautioni

The sequence AAA35784 differs from that shown. Reason: Frameshift at positions 758, 769 and 776.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti457Missing in CAA68674 (PubMed:2832506).Curated1
Sequence conflicti646A → R in AAA35784 (PubMed:2827171).Curated1
Sequence conflicti667Q → D AA sequence (PubMed:3016712).Curated1
Sequence conflicti774G → E in AAA35784 (PubMed:2827171).Curated1
Sequence conflicti783 – 787PPVTR → L in AAA35784 (PubMed:2827171).Curated5
Sequence conflicti844I → M in AAA35786 (PubMed:2563370).Curated1
Sequence conflicti844I → M in AAB04638 (PubMed:2563370).Curated1
Sequence conflicti886L → V in AAA35784 (PubMed:2827171).Curated1
Sequence conflicti890A → P in AAA35784 (PubMed:2827171).Curated1
Sequence conflicti902Q → G AA sequence (PubMed:3016712).Curated1
Sequence conflicti906H → L AA sequence (PubMed:3016712).Curated1
Isoform C (identifier: P20023-3)
Sequence conflicti663S → P in AAA35784 (PubMed:2827171).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_016164639S → N.2 PublicationsCorresponds to variant rs17615dbSNPEnsembl.1
Natural variantiVAR_016165993I → V.1 PublicationCorresponds to variant rs17258982dbSNPEnsembl.1
Natural variantiVAR_0161661003A → E.2 PublicationsCorresponds to variant rs6540433dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001208499 – 524Missing in isoform B. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_001209525 – 556ITCPP…VTYTC → NHLPTTPCYLQWGTHREFLR RFSIWNHGHLHM in isoform B. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_001210659K → KGCQSPPGLHHGRHTGGNTV FFVSGMTVDYTCDPGYLLVG NKSIHCMPSGNWSPSAPRCE in isoform C and isoform D. 5 Publications1
Alternative sequenceiVSP_001211716 – 723Missing in isoform D. 1 Publication8

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M26004 mRNA. Translation: AAA35786.1.
M26016
, M24007, M24008, M24009, M24010, M24011, M26009, M26010, M26011, M26012, M26013, M26014, M26015 Genomic DNA. Translation: AAB04638.1.
Y00649 mRNA. Translation: CAA68674.1.
J03565 mRNA. Translation: AAA35784.1. Frameshift.
AK223627 mRNA. Translation: BAD97347.1.
AK301496 mRNA. Translation: BAG63007.1.
EF064746 Genomic DNA. Translation: ABK41929.1.
AL391597, AL691452 Genomic DNA. Translation: CAH72949.1.
AL391597, AL691452 Genomic DNA. Translation: CAH72950.1.
AL691452, AL391597 Genomic DNA. Translation: CAI16729.1.
AL691452, AL391597 Genomic DNA. Translation: CAI16730.1.
BC090937 mRNA. Translation: AAH90937.1.
BC136394 mRNA. Translation: AAI36395.1.
S62696 mRNA. Translation: AAB27186.1.
CCDSiCCDS1478.1. [P20023-1]
CCDS31007.1. [P20023-3]
PIRiJL0028. PL0009.
RefSeqiNP_001006659.1. NM_001006658.2. [P20023-3]
NP_001868.2. NM_001877.4. [P20023-1]
UniGeneiHs.445757.

Genome annotation databases

EnsembliENST00000367057; ENSP00000356024; ENSG00000117322. [P20023-3]
ENST00000367058; ENSP00000356025; ENSG00000117322. [P20023-1]
GeneIDi1380.
KEGGihsa:1380.
UCSCiuc001hfv.4. human. [P20023-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M26004 mRNA. Translation: AAA35786.1.
M26016
, M24007, M24008, M24009, M24010, M24011, M26009, M26010, M26011, M26012, M26013, M26014, M26015 Genomic DNA. Translation: AAB04638.1.
Y00649 mRNA. Translation: CAA68674.1.
J03565 mRNA. Translation: AAA35784.1. Frameshift.
AK223627 mRNA. Translation: BAD97347.1.
AK301496 mRNA. Translation: BAG63007.1.
EF064746 Genomic DNA. Translation: ABK41929.1.
AL391597, AL691452 Genomic DNA. Translation: CAH72949.1.
AL391597, AL691452 Genomic DNA. Translation: CAH72950.1.
AL691452, AL391597 Genomic DNA. Translation: CAI16729.1.
AL691452, AL391597 Genomic DNA. Translation: CAI16730.1.
BC090937 mRNA. Translation: AAH90937.1.
BC136394 mRNA. Translation: AAI36395.1.
S62696 mRNA. Translation: AAB27186.1.
CCDSiCCDS1478.1. [P20023-1]
CCDS31007.1. [P20023-3]
PIRiJL0028. PL0009.
RefSeqiNP_001006659.1. NM_001006658.2. [P20023-3]
NP_001868.2. NM_001877.4. [P20023-1]
UniGeneiHs.445757.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1GHQX-ray2.04B/C21-153[»]
1LY2X-ray1.80A22-148[»]
1W2RX-ray-A21-153[»]
1W2SX-ray-B21-153[»]
2GSXX-ray-A21-971[»]
3OEDX-ray3.16C/D20-153[»]
ProteinModelPortaliP20023.
SMRiP20023.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107771. 7 interactors.
IntActiP20023. 1 interactor.
MINTiMINT-1508214.

PTM databases

iPTMnetiP20023.
PhosphoSitePlusiP20023.

Polymorphism and mutation databases

BioMutaiCR2.
DMDMi215273962.

Proteomic databases

PeptideAtlasiP20023.
PRIDEiP20023.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367057; ENSP00000356024; ENSG00000117322. [P20023-3]
ENST00000367058; ENSP00000356025; ENSG00000117322. [P20023-1]
GeneIDi1380.
KEGGihsa:1380.
UCSCiuc001hfv.4. human. [P20023-1]

Organism-specific databases

CTDi1380.
DisGeNETi1380.
GeneCardsiCR2.
GeneReviewsiCR2.
HGNCiHGNC:2336. CR2.
HPAiCAB002659.
HPA052942.
HPA060715.
MalaCardsiCR2.
MIMi120650. gene.
610927. phenotype.
614699. phenotype.
neXtProtiNX_P20023.
OpenTargetsiENSG00000117322.
Orphaneti1572. Common variable immunodeficiency.
536. Systemic lupus erythematosus.
PharmGKBiPA26857.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118803.
HOGENOMiHOG000111964.
HOVERGENiHBG005399.
InParanoidiP20023.
KOiK04012.
OMAiTVIFACM.
OrthoDBiEOG091G0054.
PhylomeDBiP20023.
TreeFamiTF316872.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000117322-MONOMER.

Miscellaneous databases

ChiTaRSiCR2. human.
EvolutionaryTraceiP20023.
GeneWikiiComplement_receptor_2.
GenomeRNAii1380.
PROiP20023.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000117322.
CleanExiHS_CR2.
ExpressionAtlasiP20023. baseline and differential.
GenevisibleiP20023. HS.

Family and domain databases

CDDicd00033. CCP. 13 hits.
InterProiIPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF00084. Sushi. 13 hits.
[Graphical view]
SMARTiSM00032. CCP. 14 hits.
[Graphical view]
SUPFAMiSSF57535. SSF57535. 15 hits.
PROSITEiPS50923. SUSHI. 15 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCR2_HUMAN
AccessioniPrimary (citable) accession number: P20023
Secondary accession number(s): C9JHD2
, Q13866, Q14212, Q53EL2, Q5BKT9, Q5SR46, Q5SR48
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1991
Last sequence update: November 25, 2008
Last modified: November 30, 2016
This is version 181 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.