Reviewed,
UniProtKB/Swiss-Prot P19802 (FMRF_LYMST)
Last modified
June 16, 2009.
Version 53.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: FMRFamide neuropeptides Cleaved into the following 14 chains: 1- Recommended name: FLRF-amide 1 2- Recommended name: QFYRI-amide 3- Recommended name: FLRF-amide 2 4- Recommended name: PN Alternative name(s): SEEPLY 5- Recommended name: FMRF-amide 1 6- Recommended name: FMRF-amide 2 7- Recommended name: FMRF-amide 3 8- Recommended name: FMRF-amide 4 9- Recommended name: FMRF-amide 5 10- Recommended name: FMRF-amide 6 11- Recommended name: FMRF-amide 7 12- Recommended name: FMRF-amide 8 13- Recommended name: FMRF-amide 9 14- Recommended name: EFLRI-amide |
| Organism | Lymnaea stagnalis (Great pond snail) |
| Taxonomic identifier | 6523 [NCBI] |
| Taxonomic lineage | Eukaryota › Metazoa › Mollusca › Gastropoda › Pulmonata › Basommatophora › Lymnaeoidea › Lymnaeidae › Lymnaea |
Protein attributes
| Sequence length | 306 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | FMRFamide induces contractions in visceral and somatic musculature as well as in the heart. May play a role as cotransmitters or modulators in a number of significant neuronal systems. |
| Subcellular location | |
| Tissue specificity | Expressed in 280 cells of the CNS including the EGP heart excitatory motoneurons. |
| Sequence similarities | Belongs to the FARP (FMRFamide related peptide) family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal |
| Molecular function | Neuropeptide |
| PTM | Amidation Cleavage on pair of basic residues |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | neuropeptide signaling pathway Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Isoform 1 and isoform 2 only share the N-terminal signal sequence. | ||||||
| Isoform 1 (identifier: P19802-1) Also known as: FMRFamide; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P42565-1) Also known as: FMRFamide-related; The sequence of this isoform can be found in the external entry P42565-1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 3 (identifier: P19802-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCSM → MYSPTLIVCLSFFHSAVTKRFLRFGRALDTT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 35 | 35 | Potential | ||||||
| Propeptide | 36 – 37 | 2 | PRO_0000009668 | ||||||
| Peptide | 40 – 43 | 4 | FLRF-amide 1 | PRO_0000009669 | |||||
| Propeptide | 46 – 56 | 11 | PRO_0000009670 | ||||||
| Peptide | 59 – 63 | 5 | QFYRI-amide | PRO_0000009671 | |||||
| Propeptide | 66 – 73 | 8 | PRO_0000009672 | ||||||
| Peptide | 76 – 79 | 4 | FLRF-amide 2 | PRO_0000009673 | |||||
| Peptide | 82 – 103 | 22 | PN Ref.4 | PRO_0000009674 | |||||
| Propeptide | 108 – 149 | 42 | PRO_0000009675 | ||||||
| Peptide | 152 – 155 | 4 | FMRF-amide 1 | PRO_0000009676 | |||||
| Propeptide | 158 – 163 | 6 | PRO_0000009677 | ||||||
| Peptide | 166 – 169 | 4 | FMRF-amide 2 | PRO_0000009678 | |||||
| Propeptide | 171 – 172 | 2 | PRO_0000009679 | ||||||
| Peptide | 173 – 176 | 4 | FMRF-amide 3 | PRO_0000009680 | |||||
| Propeptide | 179 – 184 | 6 | PRO_0000009681 | ||||||
| Peptide | 187 – 190 | 4 | FMRF-amide 4 | PRO_0000009682 | |||||
| Peptide | 194 – 197 | 4 | FMRF-amide 5 | PRO_0000009683 | |||||
| Propeptide | 200 – 204 | 5 | PRO_0000009684 | ||||||
| Peptide | 207 – 210 | 4 | FMRF-amide 6 | PRO_0000009685 | |||||
| Propeptide | 213 – 217 | 5 | PRO_0000009686 | ||||||
| Peptide | 220 – 223 | 4 | FMRF-amide 7 | PRO_0000009687 | |||||
| Propeptide | 226 – 251 | 26 | PRO_0000009688 | ||||||
| Peptide | 254 – 257 | 4 | FMRF-amide 8 | PRO_0000009689 | |||||
| Propeptide | 260 – 263 | 4 | PRO_0000009690 | ||||||
| Peptide | 266 – 269 | 4 | FMRF-amide 9 | PRO_0000009691 | |||||
| Propeptide | 272 – 278 | 7 | PRO_0000009692 | ||||||
| Peptide | 281 – 285 | 5 | EFLRI-amide | PRO_0000009693 | |||||
| Propeptide | 289 – 306 | 18 | PRO_0000009694 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 43 | 1 | Phenylalanine amide | ||||||
| Modified residue | 63 | 1 | Isoleucine amide | ||||||
| Modified residue | 79 | 1 | Phenylalanine amide | ||||||
| Modified residue | 155 | 1 | Phenylalanine amide | ||||||
| Modified residue | 169 | 1 | Phenylalanine amide | ||||||
| Modified residue | 176 | 1 | Phenylalanine amide | ||||||
| Modified residue | 190 | 1 | Phenylalanine amide | ||||||
| Modified residue | 197 | 1 | Phenylalanine amide | ||||||
| Modified residue | 210 | 1 | Phenylalanine amide | ||||||
| Modified residue | 223 | 1 | Phenylalanine amide | ||||||
| Modified residue | 257 | 1 | Phenylalanine amide | ||||||
| Modified residue | 269 | 1 | Phenylalanine amide | ||||||
| Modified residue | 285 | 1 | Isoleucine amide | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MKTWS…DMCSM → MYSPTLIVCLSFFHSAVTKR FLRFGRALDTT in isoform 3. | VSP_001564 | |||||
Experimental info | |||||||||
| Sequence conflict | 91 | 1 | L → P in AAA63280. Ref.1 | ||||||
| Sequence conflict | 273 | 1 | E → Q in AAA63280. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Cardioactive neuropeptide Phe-Met-Arg-Phe-NH2 (FMRFamide) and novel related peptides are encoded in multiple copies by a single gene in the snail Lymnaea stagnalis." Linacre A., Kellett E., Saunders S., Bright K., Benjamin P.R., Burke J.F. J. Neurosci. 10:412-419(1990) [PubMed: 1968092] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Brain. |
| [2] | "Genomic organization of the FMRFamide gene in Lymnaea: multiple exons encoding novel neuropeptides." Kellett E., Saunders S.E., Li K.W., Staddon J.W., Benjamin P.R., Burke J.F. J. Neurosci. 14:6564-6570(1994) [PubMed: 7965060] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. |
| [3] | "Cell-specific alternative RNA splicing of an FMRFamide gene transcript in the brain." Saunders S.E., Kellett E., Bright K., Benjamin P.R., Burke J.F. J. Neurosci. 12:1033-1039(1992) [PubMed: 1347559] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. Tissue: CNS. |
| [4] | "Processing of the FMRFamide precursor protein in the snail Lymnaea stagnalis: characterization and neuronal localization of a novel peptide, 'SEEPLY'." Santama N., Li K.W., Bright K.E., Yeoman M., Geraerts W.P.M., Benjamin P.R., Burke J.F. Eur. J. Neurosci. 5:1003-1016(1993) [PubMed: 7904219] [Abstract] Cited for: PROTEIN SEQUENCE OF 82-103 (PN). Tissue: CNS. |
Cross-references
Sequence databases | |
|---|---|
| M37629 mRNA. Translation: AAA63280.1. M87479 Genomic DNA. No translation available. S38686 mRNA. Translation: AAB21767.1. S94982 Genomic DNA. Translation: AAB21764.1. | |
| PIR | A37016. F44840. |
3D structure databases | |
| ModBase | Search... |
Family and domain databases | |
| InterPro | IPR002544. FMRFamid-related_peptide. [Graphical view] |
| Pfam | PF01581. FARP. 13 hits. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | FMRF_LYMST | ||||||||
| Accession | Primary (citable) accession number: P19802 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||

Clusters with


