Reviewed,
UniProtKB/Swiss-Prot P19544 (WT1_HUMAN)
Last modified
November 3, 2009.
Version 134.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Wilms tumor protein Alternative name(s): WT33 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 449 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Transcription factor that plays an important role in cellular development and cell survival. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital system. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. Ref.24 Ref.25 |
| Subunit structure | Homodimer. Interacts with WTIP. Interacts with actively translating polysomes. Detected in nuclear ribonucleoprotein (mRNP) particles. Interacts with HNRNPU via the zinc-finger region. Interacts with U2AF2 By similarity. Interacts with ZNF224 via the zinc-finger region. Interacts with WTAP and SRY. Interacts with FAM123B/WTX. |
| Subcellular location | Nucleus. Cytoplasm By similarity. Note: Shuttles between nucleus and cytoplasm By similarity. Isoform 1: Nucleus speckle. Ref.23 Isoform 4: Nucleus › nucleoplasm. Ref.23 |
| Tissue specificity | Expressed in the kidney and a subset of hematopoietic cells. |
| Involvement in disease | Defects in WT1 are the cause of Frasier syndrome (FS) [MIM:136680]. FS is characterized by a slowly progressing nephropathy leading to renal failure in adolescence or early adulthood, male pseudohermaphroditism, and no Wilms tumor. As for histological findings of the kidneys, focal glomerular sclerosis is often observed. There is phenotypic overlap with Denys-Drash syndrome. Inheritance is autosomal dominant. Ref.42 Defects in WT1 are a cause of Wilms tumor--aniridia--genitourinary anomalies--mental retardation syndrome (WAGR syndrome) [MIM:194072]. Defects in WT1 are the cause of Wilms tumor 1 (WT1) [MIM:194070]. WT is an embryonal malignancy of the kidney that affects approximately 1 in 10'000 infants and young children. It occurs both in sporadic and hereditary forms. Ref.28 Ref.38 Ref.39 Ref.47 Defects in WT1 are the cause of Denys-Drash syndrome (DDS) [MIM:194080]. DDS is a typical nephropathy characterized by diffuse mesangial sclerosis, genital abnormalities, and/or Wilms tumor. There is phenotypic overlap with WAGR syndrome and Frasier syndrome. Inheritance is autosomal dominant, but most cases are sporadic. Ref.39 Ref.11 Ref.12 Ref.29 Ref.30 Ref.31 Ref.32 Ref.33 Ref.35 Ref.36 Ref.37 Ref.40 Ref.43 Ref.44 Ref.45 Ref.46 Ref.50 Defects in WT1 are the cause of isolated diffuse mesangial sclerosis (IDMS) [MIM:256370]. IDMS is an early-onset nephrotic syndrome occurring in the absence of other abnormalities and resulting in renal failure. Inheritance is autosomal recessive. Ref.39 Ref.44 Defects in WT1 are a cause of Meacham syndrome [MIM:608978]. Meacham syndrome is a rare sporadically occurring multiple malformation syndrome characterized by male pseudohermaphroditism with abnormal internal female genitalia comprising a uterus and double or septate vagina, complex congenital heart defect and diaphragmatic abnormalities. Ref.51 Defects in WT1 are a cause of hypospadias. Hypospadias is a common malformation in which the urethra opens on the ventral side of the penis. It is considered a complex disorder with both genetic and environmental factors involved in the pathogenesis. Hypospadias can occur alone on an apparently multifactorial basis or as part of syndromes. A chromosomal aberration involving WT1 may be a cause of desmoplastic small round cell tumor (DSRCT). Translocation t(11;22)(p13;q12) with EWSR1. |
| Miscellaneous | Presence of the KTS motif hinders interactions between DNA and zinc-finger 4. |
| Sequence similarities | Belongs to the EGR C2H2-type zinc-finger protein family. Contains 4 C2H2-type zinc fingers. |
| RNA editing | |
| Sequence caution | The sequence AAB33443.1 differs from that shown. Reason: Miscellaneous discrepancy. Contaminating sequence. Sequence of unknown origin in the N-terminal part. The sequence CAA35956.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAA35956.1 differs from that shown. Reason: Miscellaneous discrepancy. Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon. The sequence described in Ref.15 differs from that shown. Reason: Miscellaneous discrepancy. Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform 1 (identifier: P19544-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Detected in nucleus speckle, may bind mRNA. | ||||||
| Isoform 2 (identifier: P19544-2) The sequence of this isoform differs from the canonical sequence as follows: 250-266: Missing. 408-410: Missing. | ||||||
| Isoform 3 (identifier: P19544-3) The sequence of this isoform differs from the canonical sequence as follows: 250-266: Missing. | ||||||
| Isoform 4 (identifier: P19544-4) The sequence of this isoform differs from the canonical sequence as follows: 408-410: Missing. | ||||||
| Note: Detected in nucleoplasm, probably functions as transcription factor. | ||||||
| Isoform 6 (identifier: P19544-6) The sequence of this isoform differs from the canonical sequence as follows: 1-144: Missing. 145-147: RNQ → MEK 408-410: Missing. | ||||||
| Isoform 7 (identifier: P19544-7) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MDFLLLQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGASGSEPQQM | ||||||
| Note: Produced by alternative initiation of isoform 1. Extended N-terminus. | ||||||
| Isoform 8 (identifier: P19544-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MDFLLLQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGASGSEPQQM 250-266: Missing. | ||||||
| Note: Produced by alternative initiation of isoform 1. Extended N-terminus. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 449 | 449 | Wilms tumor protein | PRO_0000047131 | |||||||||||
Regions | |||||||||||||||
| Zinc finger | 323 – 347 | 25 | C2H2-type 1 | ||||||||||||
| Zinc finger | 353 – 377 | 25 | C2H2-type 2 | ||||||||||||
| Zinc finger | 383 – 405 | 23 | C2H2-type 3 | ||||||||||||
| Zinc finger | 414 – 438 | 25 | C2H2-type 4 | ||||||||||||
| Region | 367 – 381 | 15 | Important for interaction with target DNA | ||||||||||||
| Region | 393 – 401 | 9 | Important for interaction with target DNA | ||||||||||||
| Motif | 408 – 410 | 3 | KTS motif | ||||||||||||
| Compositional bias | 27 – 83 | 57 | Pro-rich | ||||||||||||
Sites | |||||||||||||||
| Site | 424 | 1 | Important for interaction with target DNA | ||||||||||||
| Site | 430 | 1 | Important for interaction with target DNA | ||||||||||||
Amino acid modifications | |||||||||||||||
| Cross-link | 73 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.23 | |||||||||||||
| Cross-link | 177 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) Ref.23 | |||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 144 | 144 | Missing in isoform 6. | VSP_037582 | |||||||||||
| Alternative sequence | 1 | 1 | M → MDFLLLQDPASTCVPEPASQ HTLRSGPGCLQQPEQQGVRD PGGIWAKLGAAEASAERLQG RRSRGASGSEPQQM in isoform 7 and isoform 8. | VSP_037583 | |||||||||||
| Alternative sequence | 145 – 147 | 3 | RNQ → MEK in isoform 6. | VSP_037584 | |||||||||||
| Alternative sequence | 250 – 266 | 17 | Missing in isoform 2, isoform 3 and isoform 8. | VSP_006866 | |||||||||||
| Alternative sequence | 408 – 410 | 3 | Missing in isoform 2, isoform 4 and isoform 6. | VSP_006867 | |||||||||||
| Natural variant | 131 | 1 | A → T in hypospadias. Ref.48 | VAR_043798 | |||||||||||
| Natural variant | 181 | 1 | P → S in WT1. dbSNP rs2234584. Ref.38 Ref.47 | VAR_007739 | |||||||||||
| Natural variant | 223 | 1 | S → N in WT1. Ref.39 | VAR_007740 | |||||||||||
| Natural variant | 253 | 1 | G → A in WT1. Ref.38 | VAR_007741 | |||||||||||
| Natural variant | 273 | 1 | S → G in mesothelioma. Ref.34 | VAR_007742 | |||||||||||
| Natural variant | 281 | 1 | L → P in RNA edited version. | VAR_058021 | |||||||||||
| Natural variant | 312 | 1 | R → Q in IDMS. Ref.44 | VAR_015053 | |||||||||||
| Natural variant | 330 | 1 | C → Y in DDS. Ref.12 | VAR_007743 | |||||||||||
| Natural variant | 342 | 1 | M → R in DDS. Ref.44 | VAR_015054 | |||||||||||
| Natural variant | 355 | 1 | C → G in WT1. Ref.47 | VAR_043799 | |||||||||||
| Natural variant | 355 | 1 | C → Y in DDS. Ref.40 Ref.44 | VAR_015055 | |||||||||||
| Natural variant | 360 | 1 | C → G in DDS. | VAR_007744 | |||||||||||
| Natural variant | 360 | 1 | C → Y in DDS. Ref.33 | VAR_043800 | |||||||||||
| Natural variant | 364 | 1 | F → L in nephrotic syndrome. Ref.41 | VAR_043801 | |||||||||||
| Natural variant | 366 | 1 | R → C in WT1, DDS and Meacham syndrome. Ref.28 Ref.39 Ref.47 Ref.51 | VAR_007745 | |||||||||||
| Natural variant | 366 | 1 | R → H in DDS and WT1. Ref.47 Ref.40 Ref.44 Ref.41 | VAR_007746 | |||||||||||
| Natural variant | 366 | 1 | R → L in DDS. Ref.36 | VAR_043802 | |||||||||||
| Natural variant | 369 | 1 | Q → P in DDS. Ref.45 | VAR_043803 | |||||||||||
| Natural variant | 373 | 1 | H → Q in DDS and WT1. Ref.47 | VAR_007747 | |||||||||||
| Natural variant | 373 | 1 | H → Y in DDS. Ref.37 | VAR_015056 | |||||||||||
| Natural variant | 377 | 1 | H → R in DDS. Ref.35 | VAR_015057 | |||||||||||
| Natural variant | 377 | 1 | H → Y in IDMS. Ref.39 | VAR_007748 | |||||||||||
| Natural variant | 379 | 1 | G → C in nephrotic syndrome. Ref.41 | VAR_043804 | |||||||||||
| Natural variant | 383 | 1 | F → L in IDMS. Ref.39 | VAR_007749 | |||||||||||
| Natural variant | 385 | 1 | C → R in DDS. Ref.40 Ref.44 Ref.41 | VAR_015058 | |||||||||||
| Natural variant | 388 | 1 | C → F in DDS. Ref.44 | VAR_015059 | |||||||||||
| Natural variant | 388 | 1 | C → R in nephrotic syndrome. Ref.49 | VAR_043805 | |||||||||||
| Natural variant | 388 | 1 | C → Y in DDS. Ref.46 | VAR_043806 | |||||||||||
| Natural variant | 392 | 1 | F → L in FS. Ref.42 | VAR_015060 | |||||||||||
| Natural variant | 394 | 1 | R → L in WT1. Ref.47 | VAR_043807 | |||||||||||
| Natural variant | 394 | 1 | R → P in DDS. Ref.12 | VAR_043808 | |||||||||||
| Natural variant | 394 | 1 | R → Q in DDS. Ref.39 Ref.41 | VAR_015061 | |||||||||||
| Natural variant | 394 | 1 | R → W in DDS, WT1 and Meacham syndrome. Ref.39 Ref.47 Ref.12 Ref.32 Ref.33 Ref.44 Ref.51 Ref.41 | VAR_007750 | |||||||||||
| Natural variant | 396 | 1 | D → G in DDS. | VAR_007752 | |||||||||||
| Natural variant | 396 | 1 | D → N in DDS and IDMS. Ref.39 Ref.44 Ref.41 | VAR_007751 | |||||||||||
| Natural variant | 396 | 1 | D → Y in DDS. Ref.43 | VAR_043809 | |||||||||||
| Natural variant | 397 | 1 | H → P in nephrotic syndrome. Ref.49 | VAR_043810 | |||||||||||
| Natural variant | 398 | 1 | L → P in DDS. Ref.39 Ref.32 | VAR_015062 | |||||||||||
| Natural variant | 401 | 1 | H → Y in DDS. Ref.31 | VAR_043811 | |||||||||||
| Natural variant | 405 | 1 | H → R in DDS. Ref.50 | VAR_043812 | |||||||||||
Experimental info | |||||||||||||||
| Mutagenesis | 73 | 1 | K → R: Abolishes sumoylation; when associated with R-177. Ref.23 | ||||||||||||
| Mutagenesis | 177 | 1 | K → R: Abolishes sumoylation; when associated with R-77. Ref.23 | ||||||||||||
| Mutagenesis | 343 | 1 | H → A: Reduced RNA binding. Ref.24 | ||||||||||||
| Mutagenesis | 366 | 1 | R → A: Strongly reduced binding of DNA and RNA. Ref.24 | ||||||||||||
| Mutagenesis | 372 | 1 | R → A: Strongly reduced binding of DNA and RNA. Ref.24 | ||||||||||||
| Mutagenesis | 394 | 1 | R → A or S: Strongly reduced binding of DNA and RNA. Ref.24 | ||||||||||||
| Mutagenesis | 434 | 1 | H → A: Reduced RNA binding. Ref.24 | ||||||||||||
| Sequence conflict | 288 | 1 | I → M in AAH32861. Ref.8 | ||||||||||||
| Sequence conflict | 365 | 1 | S → F in AAA36810. Ref.9 | ||||||||||||
| Sequence conflict | 365 | 1 | S → F in AAB33443. Ref.10 | ||||||||||||
| Sequence conflict | 387 | 1 | T → A in CAA43819. Ref.3 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Beta strand | 386 – 388 | 3 | |||||||||||||
| Beta strand | 391 – 394 | 4 | |||||||||||||
| Helix | 395 – 402 | 8 | |||||||||||||
| Turn | 403 – 405 | 3 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Homozygous deletion in Wilms tumours of a zinc-finger gene identified by chromosome jumping." Gessler M., Poustka A., Cavenee W., Neve R.L., Orkin S.H., Bruns G.A.P. Nature 343:774-778(1990) [PubMed: 2154702] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). Tissue: Fetal kidney. |
| [2] | "Alternative splicing and genomic structure of the Wilms tumor gene WT1." Haber D.A., Sohn R.L., Buckler A.J., Pelletier J., Call K.M., Housman D.E. Proc. Natl. Acad. Sci. U.S.A. 88:9618-9622(1991) [PubMed: 1658787] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3 AND 4). Tissue: Placenta. |
| [3] | "The genomic organization and expression of the WT1 gene." Gessler M., Konig A., Bruns G.A.P. Genomics 12:807-813(1992) [PubMed: 1572653] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 4). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Placenta. |
| [5] | NIEHS SNPs program Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1). |
| [6] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Testis. |
| [9] | "Isolation and characterization of a zinc finger polypeptide gene at the human chromosome 11 Wilms' tumor locus." Call K.M., Glaser T., Ito C.Y., Buckler A.J., Pelletier J., Haber D.A., Rose E.A., Kral A., Yeger H., Lewis W.H., Jones C., Housman D.E. Cell 60:509-520(1990) [PubMed: 2154335] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 85-449 (ISOFORMS 2/5). |
| [10] | "High affinity binding sites for the Wilms' tumour suppressor protein WT1." Hamilton T.B., Barilla K.C., Romaniuk P.J. Nucleic Acids Res. 23:277-284(1995) [PubMed: 7862533] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 301-449 (ISOFORMS 2/4/6). Tissue: Fetal kidney. |
| [11] | "Germline mutations in the Wilms' tumor suppressor gene are associated with abnormal urogenital development in Denys-Drash syndrome." Pelletier J., Bruening W., Kashtan C.E., Mauer S.M., Manivel J.C., Striegel J.E., Houghton D.C., Junien C., Habib R., Fouser L., Fine R.N., Silverman B.L., Haber D.A., Housman D.E. Cell 67:437-447(1991) [PubMed: 1655284] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 385-405, VARIANTS DDS. |
| [12] | "Germline intronic and exonic mutations in the Wilms' tumour gene (WT1) affecting urogenital development." Bruening W., Bardeesy N., Silverman B.L., Cohn R.A., Machin G.A., Aronson A.J., Housman D., Pelletier J. Nat. Genet. 1:144-148(1992) [PubMed: 1302008] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 385-405, VARIANTS DDS TYR-330; PRO-394 AND TRP-394. |
| [13] | "Isolation, characterization, and expression of the murine Wilms' tumor gene (WT1) during kidney development." Buckler A.J., Pelletier J., Haber D.A., Glaser T., Housman D.E. Mol. Cell. Biol. 11:1707-1712(1991) [PubMed: 1671709] [Abstract] Cited for: IDENTIFICATION OF START CODON, ALTERNATIVE SPLICING. |
| [14] | "RNA editing in the Wilms' tumor susceptibility gene, WT1." Sharma P.M., Bowman M., Madden S.L., Rauscher F.J. III, Sukumar S. Genes Dev. 8:720-731(1994) [PubMed: 7926762] [Abstract] Cited for: RNA EDITING OF POSITION 281. |
| [15] | "A non-AUG translational initiation event generates novel WT1 isoforms." Bruening W., Pelletier J. J. Biol. Chem. 271:8646-8654(1996) [PubMed: 8621495] [Abstract] Cited for: ALTERNATIVE INITIATION, ALTERNATIVE SPLICING (ISOFORMS 7 AND 8). |
| [16] | "Identification of WTAP, a novel Wilms' tumour 1-associating protein." Little N.A., Hastie N.D., Davies R.C. Hum. Mol. Genet. 9:2231-2239(2000) [PubMed: 11001926] [Abstract] Cited for: INTERACTION WITH WTAP. |
| [17] | "Inhibition of Wilms tumor 1 transactivation by bone marrow zinc finger 2, a novel transcriptional repressor." Lee T.H., Lwu S., Kim J., Pelletier J. J. Biol. Chem. 277:44826-44837(2002) [PubMed: 12239212] [Abstract] Cited for: INTERACTION WITH ZNF224. |
| [18] | "Transcriptional activity of testis-determining factor SRY is modulated by the Wilms' tumor 1 gene product, WT1." Matsuzawa-Watanabe Y., Inoue J., Semba K. Oncogene 22:7900-7904(2003) [PubMed: 12970737] [Abstract] Cited for: INTERACTION WITH SRY. |
| [19] | "WT1: a novel tumor suppressor gene inactivated in Wilms' tumor." Haber D.A., Buckler A.J. New Biol. 4:97-106(1992) [PubMed: 1313285] [Abstract] Cited for: REVIEW. |
| [20] | "The WT1 Wilms tumor gene product: a developmentally regulated transcription factor in the kidney that functions as a tumor suppressor." Rauscher F.J. III FASEB J. 7:896-903(1993) [PubMed: 8393820] [Abstract] Cited for: REVIEW. |
| [21] | "WT1 mutations contribute to abnormal genital system development and hereditary Wilms' tumour." Pelletier J., Bruening W., Li F.P., Haber D.A., Glaser T., Housman D.E. Nature 353:431-434(1991) [PubMed: 1654525] [Abstract] Cited for: INVOLVEMENT IN WAGR SYNDROME. |
| [22] | "A tumor suppressor and oncogene: the WT1 story." Yang L., Han Y., Suarez Saiz F., Minden M.D. Leukemia 21:868-876(2007) [PubMed: 17361230] [Abstract] Cited for: REVIEW. |
| [23] | "SUMO-1 modification of the Wilms' tumor suppressor WT1." Smolen G.A., Vassileva M.T., Wells J., Matunis M.J., Haber D.A. Cancer Res. 64:7846-7851(2004) [PubMed: 15520190] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-73 AND LYS-177, SUMOYLATION AT LYS-73 AND LYS-177. |
| [24] | "Contribution of individual amino acids to the RNA binding activity of the Wilms' tumor suppressor protein WT1." Weiss T.C., Romaniuk P.J. Biochemistry 48:148-155(2009) [PubMed: 19123921] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF HIS-343; ARG-366; ARG-372; ARG-394 AND HIS-434. |
| [25] | "The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity." Rivera M.N., Kim W.J., Wells J., Stone A., Burger A., Coffman E.J., Zhang J., Haber D.A. Proc. Natl. Acad. Sci. U.S.A. 106:8338-8343(2009) [PubMed: 19416806] [Abstract] Cited for: INTERACTION WITH FAM123B/WTX, FUNCTION. |
| [26] | "Why zinc fingers prefer zinc: ligand-field symmetry and the hidden thermodynamics of metal ion selectivity." Lachenmann M.J., Ladbury J.E., Dong J., Huang K., Carey P., Weiss M.A. Biochemistry 43:13910-13925(2004) [PubMed: 15518539] [Abstract] Cited for: STRUCTURE BY NMR OF 381-407 IN COMPLEX WITH ZINC IONS. |
| [27] | "Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA." Stoll R., Lee B.M., Debler E.W., Laity J.H., Wilson I.A., Dyson H.J., Wright P.E. J. Mol. Biol. 372:1227-1245(2007) [PubMed: 17716689] [Abstract] Cited for: STRUCTURE BY NMR OF 318-438 IN COMPLEX WITH DNA AND ZINC IONS (ISOFORM 4), X-RAY CRYSTALLOGRAPHY (3.15 ANGSTROMS) OF 318-438 IN COMPLEX WITH DNA AND ZINC IONS. |
| [28] | "Zinc finger point mutations within the WT1 gene in Wilms tumor patients." Little M.H., Prosser J., Condie A., Smith P.J., van Heyningen V., Hastie N.D. Proc. Natl. Acad. Sci. U.S.A. 89:4791-4795(1992) [PubMed: 1317572] [Abstract] Cited for: VARIANT WT1 CYS-366. |
| [29] | "Constitutional mutations in the WT1 gene in patients with Denys-Drash syndrome." Baird P.N., Santos A., Groves N., Jadresic L., Cowell J.K. Hum. Mol. Genet. 1:301-305(1992) [PubMed: 1338906] [Abstract] Cited for: VARIANTS DDS. |
| [30] | "Evidence that WT1 mutations in Denys-Drash syndrome patients may act in a dominant-negative fashion." Little M.H., Williamson K.A., Mannens M., Kelsey A., Gosden C., Hastie N.D., van Heyningen V. Hum. Mol. Genet. 2:259-264(1993) [PubMed: 8388765] [Abstract] Cited for: VARIANTS DDS. |
| [31] | "A novel zinc finger mutation in a patient with Denys-Drash syndrome." Baird P.N., Cowell J.K. Hum. Mol. Genet. 2:2193-2194(1993) [PubMed: 8111391] [Abstract] Cited for: VARIANT DDS TYR-401. |
| [32] | "Molecular analysis of two Japanese cases of Denys-Drash syndrome." Tsuda M., Sakiyama T., Kitagawa T., Watanabe S., Watanabe T., Takahashi S., Kawaguchi H., Ito K. J. Inherit. Metab. Dis. 16:876-880(1993) [PubMed: 8295405] [Abstract] Cited for: VARIANTS DDS TRP-394 AND PRO-398. |
| [33] | "Mutational screening of the Wilms's tumour gene, WT1, in males with genital abnormalities." Clarkson P.A., Davies H.R., Williams D.M., Chaudhary R., Hughes I.A., Patterson M.N. J. Med. Genet. 30:767-772(1993) [PubMed: 8411073] [Abstract] Cited for: VARIANTS DDS TYR-360 AND TRP-394. |
| [34] | "The Wilms tumour gene WT1 is expressed in murine mesoderm-derived tissues and mutated in a human mesothelioma." Park S., Schalling M., Bernard A., Maheswaran S., Shipley G.C., Roberts D., Fletcher J., Shipman R., Rheinwald J., Demetri G., Griffin J., Minden M., Housman D.E., Haber D.A. Nat. Genet. 4:415-420(1993) [PubMed: 8401592] [Abstract] Cited for: VARIANT MESOTHELIOMA GLY-273. |
| [35] | "WT1 mutations in patients with Denys-Drash syndrome: a novel mutation in exon 8 and paternal allele origin." Nordenskjold A., Friedman E., Anvret M. Hum. Genet. 93:115-120(1994) [PubMed: 8112732] [Abstract] Cited for: VARIANT DDS ARG-377. |
| [36] | "A newly identified exonic mutation of the WT1 gene in a patient with Denys-Drash syndrome." Tsuda M., Sakiyama T., Owada M., Chiba Y. Acta Paediatr. Jpn. Overseas Ed. 38:265-266(1996) [PubMed: 8741319] [Abstract] Cited for: VARIANT DDS LEU-366. |
| [37] | "A novel mutation H373Y in the Wilms' tumor suppressor gene, WT1, associated with Denys-Drash syndrome." Ghahremani M., Chan C.B., Bistritzer T., Aladjem M.M., Tieder M., Pelletier J. Hum. Hered. 46:336-338(1996) [PubMed: 8956030] [Abstract] Cited for: VARIANT DDS TYR-373. |
| [38] | "Correlation of germ-line mutations and two-hit inactivation of the WT1 gene with Wilms tumors of stromal-predominant histology." Schumacher V., Schneider S., Figge A., Wildhardt G., Harms D., Schmidt D., Weirich A., Ludwig R., Royer-Pokora B. Proc. Natl. Acad. Sci. U.S.A. 94:3972-3977(1997) [PubMed: 9108089] [Abstract] Cited for: VARIANTS WT1 SER-181 AND ALA-253. |
| [39] | "Identification of constitutional WT1 mutations, in patients with isolated diffuse mesangial sclerosis, and analysis of genotype/phenotype correlations by use of a computerized mutation database." Jeanpierre C., Denamur E., Henry I., Cabanis M.-O., Luce S., Cecille A., Elion J., Peuchmaur M., Loirat C., Niaudet P., Gubler M.-C., Junien C. Am. J. Hum. Genet. 62:824-833(1998) [PubMed: 9529364] [Abstract] Cited for: VARIANTS IDMS TYR-377; LEU-383 AND ASN-396, VARIANTS DDS CYS-366; GLN-394; TRP-394 AND PRO-398, VARIANT WT1 ASN-223. |
| [40] | "Do intronic mutations affecting splicing of WT1 exon 9 cause Frasier syndrome?" Kikuchi H., Takata A., Akasaka Y., Fukuzawa R., Yoneyama H., Kurosawa Y., Honda M., Kamiyama Y., Hata J. J. Med. Genet. 35:45-48(1998) [PubMed: 9475094] [Abstract] Cited for: VARIANTS DDS TYR-355; HIS-366 AND ARG-385. |
| [41] | "Spectrum of early onset nephrotic syndrome associated with WT1 missense mutations." Schumacher V., Schaerer K., Wuehl E., Altrogge H., Bonzel K.-E., Guschmann M., Neuhaus T.J., Pollastro R.M., Kuwertz-Broeking E., Bulla M., Tondera A.-M., Mundel P., Helmchen U., Waldherr R., Weirich A., Royer-Pokora B. Kidney Int. 53:1594-1600(1998) [PubMed: 9607189] [Abstract] Cited for: VARIANTS NEPHROTIC SYNDROME LEU-364; HIS-366; CYS-379; ARG-385; GLN-394; TRP-394 AND ASN-396. |
| [42] | "Exon 9 mutations in the WT1 gene, without influencing KTS splice isoforms, are also responsible for Frasier syndrome." Kohsaka T., Tagawa M., Takekoshi Y., Yanagisawa H., Tadokoro K., Yamada M. Hum. Mutat. 14:466-470(1999) [PubMed: 10571943] [Abstract] Cited for: VARIANT FS LEU-392. |
| [43] | "Novel WT1 exon 9 mutation (D396Y) in a patient with early onset Denys Drash syndrome." Little M., Carman G., Donaldson E. Hum. Mutat. 15:389-389(2000) [PubMed: 10738002] [Abstract] Cited for: VARIANT DDS TYR-396. |
| [44] | "Constitutional WT1 correlate with clinical features in children with progressive nephropathy." Takata A., Kikuchi H., Fukuzawa R., Ito S., Honda M., Hata J. J. Med. Genet. 37:698-701(2000) [PubMed: 11182928] [Abstract] Cited for: VARIANTS DDS ARG-342; TYR-355; HIS-366; ARG-385; PHE-388; TRP-394 AND ASN-396, VARIANT IDMS GLN-312. |
| [45] | "A novel missense mutation of the WT1 gene causing Denys-Drash syndrome with exceptionally mild renal manifestations." Ohta S., Ozawa T., Izumino K., Sakuragawa N., Fuse H. J. Urol. 163:1857-1858(2000) [PubMed: 10799199] [Abstract] Cited for: VARIANT DDS PRO-369. |
| [46] | "Novel WT1 mutation (C388Y) in a female child with Denys-Drash syndrome." Swiatecka-Urban A., Mokrzycki M.H., Kaskel F., Da Silva F., Denamur E. Pediatr. Nephrol. 16:627-630(2001) [PubMed: 11519891] [Abstract] Cited for: VARIANT DDS TYR-388. |
| [47] | "Twenty-four new cases of WT1 germline mutations and review of the literature: genotype/phenotype correlations for Wilms tumor development." Royer-Pokora B., Beier M., Henzler M., Alam R., Schumacher V., Weirich A., Huff V. Am. J. Med. Genet. A 127:249-257(2004) [PubMed: 15150775] [Abstract] Cited for: VARIANTS WT1 SER-181; GLY-355; CYS-366; HIS-366; GLN-373; TRP-394 AND LEU-394. |
| [48] | "Mutation analysis of five candidate genes in Chinese patients with hypospadias." Wang Y., Li Q., Xu J., Liu Q., Wang W., Lin Y., Ma F., Chen T., Li S., Shen Y. Eur. J. Hum. Genet. 12:706-712(2004) [PubMed: 15266301] [Abstract] Cited for: VARIANT HYPOSPADIAS THR-131. |
| [49] | "Prevalence of WT1 mutations in a large cohort of patients with steroid-resistant and steroid-sensitive nephrotic syndrome." Members of the APN study group Ruf R.G., Schultheiss M., Lichtenberger A., Karle S.M., Zalewski I., Mucha B., Everding A.S., Neuhaus T., Patzer L., Plank C., Haas J.P., Ozaltin F., Imm A., Fuchshuber A., Bakkaloglu A., Hildebrandt F. Kidney Int. 66:564-570(2004) [PubMed: 15253707] [Abstract] Cited for: VARIANTS NEPHROTIC SYNDROME ARG-388 AND PRO-397. |
| [50] | "A novel mutation of WT1 exon 9 in a patient with Denys-Drash syndrome and pyloric stenosis." Hu M., Craig J., Howard N., Kan A., Chaitow J., Little D., Alexander S.I. Pediatr. Nephrol. 19:1160-1163(2004) [PubMed: 15349765] [Abstract] Cited for: VARIANT DDS ARG-405. |
| [51] | "WT1 mutations in Meacham syndrome suggest a coelomic mesothelial origin of the cardiac and diaphragmatic malformations." Suri M., Kelehan P., O'neill D., Vadeyar S., Grant J., Ahmed S.F., Tolmie J., McCann E., Lam W., Smith S., FitzPatrick D., Hastie N.D., Reardon W. Am. J. Med. Genet. A 143:2312-2320(2007) [PubMed: 17853480] [Abstract] Cited for: VARIANTS MEACHAM SYNDROME CYS-366 AND TRP-394. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| X51630 mRNA. Translation: CAA35956.1. Sequence problems. M80232 M80231 Genomic DNA. Translation: AAA61299.1. X61631 X61638 Genomic DNA. Translation: CAA43819.1. AK291736 mRNA. Translation: BAF84425.1. AY245105 Genomic DNA. Translation: AAO61088.1. AL049692 Genomic DNA. Translation: CAC39220.3. Different initiation. AL049692 Genomic DNA. Translation: CAI95758.2. Different initiation. AL049692 Genomic DNA. Translation: CAI95759.2. Different initiation. AL049692 Genomic DNA. Translation: CAI95760.1. CH471064 Genomic DNA. Translation: EAW68220.1. CH471064 Genomic DNA. Translation: EAW68224.1. BC032861 mRNA. Translation: AAH32861.1. M30393 mRNA. Translation: AAA36810.1. S75264 mRNA. Translation: AAB33443.1. Sequence problems. S61515 Genomic DNA. Translation: AAB20110.1. S61522 Genomic DNA. Translation: AAB20111.1. S61524 Genomic DNA. Translation: AAB20112.1. S60755 Genomic DNA. Translation: AAC60605.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00019517. IPI00374173. IPI00550100. IPI00853526. IPI00935507. IPI00935900. IPI00936595. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A38080. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000369.3. NP_077742.2. NP_077743.2. NP_077744.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.591980 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P19544. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000332351; ENSP00000331327; ENSG00000184937; Homo sapiens. [Genome view] ENST00000379077; ENSP00000368368; ENSG00000184937; Homo sapiens. [Genome view] ENST00000379079; ENSP00000368370; ENSG00000184937; Homo sapiens. [Genome view] ENST00000448076; ENSP00000413452; ENSG00000184937; Homo sapiens. [Genome view] ENST00000452863; ENSP00000415516; ENSG00000184937; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 7490. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:7490. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001mtn.1. human. uc001mto.1. human. uc001mtp.1. human. uc001mtq.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 7490. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M032365. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0000516. HIX0009531. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12796. WT1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 136680. phenotype. 194070. phenotype. 194072. phenotype. 194080. phenotype. 256370. phenotype. 607102. gene. 608978. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 220. Denys-Drash syndrome. 347. Frasier syndrome. 3097. Meacham syndrome. 804. Mesangial sclerosis, diffuse. 654. Nephroblastoma. 84271. Nephrotic syndrome, idiopathic, steroid-resistant, sporadic. 93220. Nephrotic syndrome, idiopathic, steroid-resistant, with diffuse mesangial sclerosis, sporadic. 893. WAGR syndrome. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37395. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | telomerasepathway. Regulation of Telomerase. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_WT1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P19544. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000184937. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000976. Wilms_tumour. IPR017987. Wilms_tumour_rgn_bac. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.160.60. Znf_C2H2/integrase_DNA-bd. 4 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02165. WT1. 1 hit. PF00096. zf-C2H2. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00049. WILMSTUMOUR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD000003. Znf_C2H2. 2 hits. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00355. ZnF_C2H2. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 4 hits. PS50157. ZINC_FINGER_C2H2_2. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 29336. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | WT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P19544 Secondary accession number(s): A8K6S1 Q8IYZ5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


