Reviewed,
UniProtKB/Swiss-Prot P19339 (SXL_DROME)
Last modified
February 9, 2010.
Version 117.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Protein sex-lethal | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 354 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Sex determination switch protein which controls sexual development by sex-specific splicing. Regulates dosage compensation in females by suppressing hyperactivation of X-linked genes. Expression of the embryo-specific isoform is under the control of primary sex-determining signal, which depends on the ratio of X chromosomes relative to autosomes (X:A ratio). Expression occurs in 2X:2A cells, but not in X:2A cells. The X:A ratio seems to be signaled by the relative concentration of the X-linked transcription factors SIS-A and SIS-B. As a result, the embryo-specific product is expressed early only in female embryos and specifies female-adult specific splicing; in the male where it is not expressed, the default splicing gives rise to a truncated non-functional protein. The female-specific isoform specifies the splicing of its own transcript, thereby initiating a positive autoregulatory feedback loop leading to female development pathway. The female-specific isoform controls the sex-specific splicing of transformer (TRA); acts as a translational repressor for male-specific lethal-2 (MSL-2) and prevents male-less (MLE), MSL-1 and MSL-3 proteins from associating with the female X chromosome. Ref.1 Ref.2 Ref.6 |
| Subunit structure | Part of a complex containing fl2d, Sxl and vir. |
| Tissue specificity | Expressed in somatic tissues, but not in the pole cells, which are the precursors of the germline. |
| Developmental stage | Isoform 1 is embryo-specific. Isoform CM1 is male-specific. Isoforms MS3, MS11 and MS16 are female specific. Isoform 1 is expressed for a brief period during the syncytial blastoderm stage. Isoform MS11 is expressed in 4-7 hours embryo. Ref.1 Ref.2 |
| Domain | The Gly-Asn rich domain is required for the cooperative interaction with RNA and for regulating the splicing activity. |
| Sequence similarities | Contains 2 RRM (RNA recognition motif) domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 1 | EBI-199603,EBI-199603 | ||
| Q9VWI4 | 1 | EBI-199603,EBI-88331 | ||
| Q9W579 | 1 | EBI-199603,EBI-164781 | ||
| CG9624-RA | Q9VFL8 | 1 | EBI-199603,EBI-112485 | |
| Dredd | O77260 | 1 | EBI-199603,EBI-196048 | |
| Nup58 | Q9VDV3 | 1 | EBI-199603,EBI-123251 | |
| serp | Q9VW34 | 1 | EBI-199603,EBI-178576 |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | |||||||||
| Isoform MS3 (identifier: P19339-1) Also known as: CF1; D; female-specific; L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 1 (identifier: P19339-2) The sequence of this isoform differs from the canonical sequence as follows: 1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 15 | 1 | S → C in AAA28885. Ref.1 | ||||||
| Isoform A (identifier: P19339-10) Also known as: E; The sequence of this isoform differs from the canonical sequence as follows: 1-32: Missing. 42-49: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform C (identifier: P19339-8) Also known as: N; The sequence of this isoform differs from the canonical sequence as follows: 1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA 42-49: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform CM1 (identifier: P19339-3) Also known as: B; F; The sequence of this isoform differs from the canonical sequence as follows: 26-48: SGGRGFGMSHSLPSGMSRYAFSP → RHIFFHSPERSSHHYHRKAKDTH 49-354: Missing. | |||||||||
| Isoform G (identifier: P19339-7) Also known as: J; The sequence of this isoform differs from the canonical sequence as follows: 42-49: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform I (identifier: P19339-9) The sequence of this isoform differs from the canonical sequence as follows: 3-25: GNNNPGSNNNNGGYPPYGYNNKS → RNGIDSSY | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform K (identifier: P19339-11) The sequence of this isoform differs from the canonical sequence as follows: 27-42: GGRGFGMSHSLPSGMS → PERSSHHYHRKAKDTH 43-354: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform MS11 (identifier: P19339-4) Also known as: H; The sequence of this isoform differs from the canonical sequence as follows: 42-49: Missing. 332-354: GRSIKSQQRFQNSHPYFDAKKFI → DGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYL | |||||||||
| Isoform MS16 (identifier: P19339-5) The sequence of this isoform differs from the canonical sequence as follows: 332-354: GRSIKSQQRFQNSHPYFDAKKFI → GENFADLLDGLYRRKYHYPYL | |||||||||
| Isoform O (identifier: P19339-6) The sequence of this isoform differs from the canonical sequence as follows: 1-25: MYGNNNPGSNNNNGGYPPYGYNNKS → MDFNFDTVTPCSTMSSYYNFKMA 42-49: Missing. 332-354: GRSIKSQQRFQNSHPYFDAKKFI → DGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYL | |||||||||
| Note: No experimental confirmation available. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 354 | 354 | Protein sex-lethal | PRO_0000081967 | |||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Domain | 125 – 203 | 79 | RRM 1 | ||||||||||||||||||||||||||||||||||||
| Domain | 211 – 291 | 81 | RRM 2 | ||||||||||||||||||||||||||||||||||||
| Compositional bias | 1 – 32 | 32 | Asn/Gly-rich | ||||||||||||||||||||||||||||||||||||
| Compositional bias | 57 – 60 | 4 | Poly-Ser | ||||||||||||||||||||||||||||||||||||
| Compositional bias | 312 – 319 | 8 | Poly-Pro | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 32 | 32 | Missing in isoform A. | VSP_019287 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 25 | 25 | MYGNN…YNNKS → MDFNFDTVTPCSTMSSYYNF KMA in isoform 1, isoform C and isoform O. | VSP_005881 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 3 – 25 | 23 | GNNNP…YNNKS → RNGIDSSY in isoform I. | VSP_019288 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 26 – 48 | 23 | SGGRG…YAFSP → RHIFFHSPERSSHHYHRKAK DTH in isoform CM1. | VSP_005882 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 27 – 42 | 16 | GGRGF…PSGMS → PERSSHHYHRKAKDTH in isoform K. | VSP_019289 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 42 – 49 | 8 | Missing in isoform A, isoform C, isoform G, isoform MS11 and isoform O. | VSP_005883 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 43 – 354 | 312 | Missing in isoform K. | VSP_019290 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 49 – 354 | 306 | Missing in isoform CM1. | VSP_005884 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 332 – 354 | 23 | GRSIK…AKKFI → DGAMEKLRSLFDAICDAIFG LDSENFADLLDGLYRRKYHY PYL in isoform MS11 and isoform O. | VSP_005885 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 332 – 354 | 23 | GRSIK…AKKFI → GENFADLLDGLYRRKYHYPY L in isoform MS16. | VSP_005886 | |||||||||||||||||||||||||||||||||||
| Natural variant | 93 | 1 | P → S | ||||||||||||||||||||||||||||||||||||
| Natural variant | 96 | 1 | S → G | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 125 – 130 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 138 – 146 | 9 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 155 | 5 | |||||||||||||||||||||||||||||||||||||
| Turn | 160 – 163 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 167 – 175 | 9 | |||||||||||||||||||||||||||||||||||||
| Helix | 176 – 186 | 11 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 197 – 200 | 4 | |||||||||||||||||||||||||||||||||||||
| Turn | 207 – 210 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 212 – 217 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 224 – 231 | 8 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 233 – 235 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 244 | 8 | |||||||||||||||||||||||||||||||||||||
| Turn | 246 – 248 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 261 | 11 | |||||||||||||||||||||||||||||||||||||
| Helix | 262 – 272 | 11 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 285 – 288 | 4 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sex-lethal, a Drosophila sex determination switch gene, exhibits sex-specific RNA splicing and sequence similarity to RNA binding proteins." Bell L.R., Maine E.M., Schedl P., Cline T.W. Cell 55:1037-1046(1988) [PubMed: 3144435] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MS3 AND CM1), FUNCTION, DEVELOPMENTAL STAGE. Strain: Oregon-R. |
| [2] | "The complex set of late transcripts from the Drosophila sex determination gene sex-lethal encodes multiple related polypeptides." Samuels M.E., Schedl P., Cline T.W. Mol. Cell. Biol. 11:3584-3602(1991) [PubMed: 1710769] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MS3; MS11 AND MS16), FUNCTION, DEVELOPMENTAL STAGE. Tissue: Embryo. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. |
| [5] | Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J.W., Champe M., Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E., George R.A., Gonzalez M., Guarin H., Kronmiller B., Li P.W., Liao G., Miranda A. Celniker S.E.Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MS16). Strain: Berkeley. Tissue: Embryo. |
| [6] | "The primary sex determination signal of Drosophila acts at the level of transcription." Keyes L.N., Cline T.W., Schedl P. Cell 68:933-943(1992) [PubMed: 1547493] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-26 (ISOFORM 1), FUNCTION. Tissue: Embryo. |
| [7] | "Regulation of the gene Sex-lethal: a comparative analysis of Drosophila melanogaster and Drosophila subobscura." Penalva L.O.F., Sakamoto H., Navarro-Sabate A., Sakashita E., Granadino B., Segarra C., Sanchez L. Genetics 144:1653-1664(1996) [PubMed: 8978052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-41 (ISOFORM MS3). |
| [8] | "Control of Drosophila Sex-lethal pre-mRNA splicing by its own female-specific product." Sakamoto H., Inoue K., Higuchi I., Ono Y., Shimura Y. Nucleic Acids Res. 20:5533-5540(1992) [PubMed: 1454517] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [9] | "Biochemical function of female-lethal (2)D/Wilms' tumor suppressor-1-associated proteins in alternative pre-mRNA splicing." Ortega A., Niksic M., Bachi A., Wilm M., Sanchez L., Hastie N., Valcarcel J. J. Biol. Chem. 278:3040-3047(2003) [PubMed: 12444081] [Abstract] Cited for: IDENTIFICATION IN COMPLEX WITH FL(2)D AND VIR. |
| [10] | "Resonance assignments and solution structure of the second RNA-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance." Lee A.L., Kanaar R., Rio D.C., Wemmer D.E. Biochemistry 33:13775-13786(1994) [PubMed: 7524663] [Abstract] Cited for: STRUCTURE BY NMR OF 199-294. |
| [11] | "A characteristic arrangement of aromatic amino acid residues in the solution structure of the amino-terminal RNA-binding domain of Drosophila sex-lethal." Inoue M., Muto Y., Sakamoto H., Kigawa T., Takio K., Shimura Y., Yokoyama S. J. Mol. Biol. 272:82-94(1997) [PubMed: 9299339] [Abstract] Cited for: STRUCTURE BY NMR OF 122-209. |
| [12] | "Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein." Handa N., Nureki O., Kurimoto K., Kim I., Sakamoto H., Shimura Y., Muto Y., Yokoyama S. Nature 398:579-585(1999) [PubMed: 10217141] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 122-289, RNA-BINDING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M23635 mRNA. Translation: AAA28885.1. M23636 mRNA. Translation: AAA28884.1. M59447 mRNA. Translation: AAA28922.1. M59448 mRNA. Translation: AAA28921.1. AE014298 Genomic DNA. Translation: AAG22410.1. AE014298 Genomic DNA. Translation: AAF46240.2. AE014298 Genomic DNA. Translation: AAF46241.3. AE014298 Genomic DNA. Translation: AAN09197.1. AE014298 Genomic DNA. Translation: AAN09200.2. AE014298 Genomic DNA. Translation: AAN09201.2. AE014298 Genomic DNA. Translation: AAO41638.2. AE014298 Genomic DNA. Translation: AAZ52509.1. AE014298 Genomic DNA. Translation: AAZ52511.1. AE014298 Genomic DNA. Translation: AAZ52513.1. AE014298 Genomic DNA. Translation: AAZ52514.1. BT003583 mRNA. Translation: AAO39587.1. S88324 Genomic DNA. Translation: AAB21845.1. D84425 Genomic DNA. Translation: BAA20294.1. | ||||||||||||||||||||||||||||||
| PIR | A31639. B31639. A39725. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001027062.1. NP_001027063.1. NP_001027064.1. NP_001027065.1. NP_001027066.1. NP_001162686.1. NP_001162687.1. NP_001162690.1. NP_001162691.1. NP_524791.3. NP_727160.2. NP_727161.2. NP_727162.2. NP_727163.2. NP_727164.2. NP_727165.2. NP_727166.2. NP_727167.2. NP_727168.1. | ||||||||||||||||||||||||||||||
| UniGene | Dm.4502 | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | P19339. 69 interactions. | ||||||||||||||||||||||||||||||
| STRING | P19339. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | P19339. | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | FBtr0100200; FBpp0099570; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100201; FBpp0099571; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100202; FBpp0099572; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100203; FBpp0099573; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100205; FBpp0099575; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100206; FBpp0099576; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100207; FBpp0099577; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100208; FBpp0099578; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100209; FBpp0099579; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100210; FBpp0099580; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100211; FBpp0099581; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100212; FBpp0099582; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100214; FBpp0099584; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100215; FBpp0099585; FBgn0003659; Drosophila melanogaster. [Genome view] FBtr0100217; FBpp0099587; FBgn0003659; Drosophila melanogaster. [Genome view] | ||||||||||||||||||||||||||||||
| GeneID | 3772180. | ||||||||||||||||||||||||||||||
| KEGG | dme:Dmel_CG18350. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 3772180. | ||||||||||||||||||||||||||||||
| FlyBase | FBgn0003659. Sxl. | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | inNOG07181. | ||||||||||||||||||||||||||||||
| InParanoid | P19339. | ||||||||||||||||||||||||||||||
| OMA | TIVQKNI. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG99CQFD. | ||||||||||||||||||||||||||||||
| PhylomeDB | P19339. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| BioCyc | DMEL-XXX-02:DMEL-XXX-02-000922-MONOMER. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| GermOnline | CG18350. Drosophila melanogaster. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR012677. a_b_plait_nuc_bd. IPR002343. Hud_Sxl_RNA. IPR000504. RRM_RNP1. IPR006546. Sex_lethal_SF. [Graphical view] | ||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 2 hits. | ||||||||||||||||||||||||||||||
| Pfam | PF00076. RRM_1. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| PRINTS | PR00961. HUDSXLRNA. | ||||||||||||||||||||||||||||||
| SMART | SM00360. RRM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01659. sex-lethal. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS50102. RRM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||
| NextBio | 852740. | ||||||||||||||||||||||||||||||
Entry information
| Entry name | SXL_DROME | ||||||||
| Accession | Primary (citable) accession number: P19339 Secondary accession number(s): A4V435 Q9W3S6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


