Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclic AMP-dependent transcription factor ATF-3

Gene

ATF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-380994 ATF4 activates genes
SignaLinkiP18847
SIGNORiP18847

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclic AMP-dependent transcription factor ATF-3
Short name:
cAMP-dependent transcription factor ATF-3
Alternative name(s):
Activating transcription factor 3
Gene namesi
Name:ATF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162772.16
HGNCiHGNC:785 ATF3
MIMi603148 gene
neXtProtiNX_P18847

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi467
OpenTargetsiENSG00000162772
PharmGKBiPA25085

Chemistry databases

DrugBankiDB00852 Pseudoephedrine

Polymorphism and mutation databases

BioMutaiATF3
DMDMi1168543

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000765811 – 181Cyclic AMP-dependent transcription factor ATF-3Add BLAST181

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki78Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei162PhosphothreonineCombined sources1
Cross-linki175Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP18847
PaxDbiP18847
PeptideAtlasiP18847
PRIDEiP18847
TopDownProteomicsiP18847-1 [P18847-1]

PTM databases

iPTMnetiP18847
PhosphoSitePlusiP18847

Expressioni

Gene expression databases

BgeeiENSG00000162772
CleanExiHS_ATF3
ExpressionAtlasiP18847 baseline and differential
GenevisibleiP18847 HS

Organism-specific databases

HPAiHPA001562

Interactioni

Subunit structurei

Binds DNA as a homodimer or a heterodimer.

Binary interactionsi

Show more details

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • protein heterodimerization activity Source: ParkinsonsUK-UCL
  • protein homodimerization activity Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi106957, 61 interactors
CORUMiP18847
DIPiDIP-344N
IntActiP18847, 34 interactors
MINTiP18847
STRINGi9606.ENSP00000344352

Structurei

3D structure databases

ProteinModelPortaliP18847
SMRiP18847
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini86 – 149bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni88 – 110Basic motifPROSITE-ProRule annotationAdd BLAST23
Regioni114 – 142Leucine-zipperPROSITE-ProRule annotationAdd BLAST29

Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Curated

Phylogenomic databases

eggNOGiKOG1414 Eukaryota
ENOG4111CH5 LUCA
GeneTreeiENSGT00730000110847
HOGENOMiHOG000034126
HOVERGENiHBG003381
InParanoidiP18847
KOiK09032
OMAiLVYMLNL
OrthoDBiEOG091G0M4N
PhylomeDBiP18847
TreeFamiTF326301

Family and domain databases

InterProiView protein in InterPro
IPR000837 AP-1
IPR029812 ATF3
IPR004827 bZIP
PANTHERiPTHR23351 PTHR23351, 1 hit
PTHR23351:SF23 PTHR23351:SF23, 1 hit
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
PRINTSiPR00042 LEUZIPPRFOS
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P18847-1) [UniParc]FASTAAdd to basket
Also known as: ATF3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ
60 70 80 90 100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA
110 120 130 140 150
AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR
160 170 180
PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S
Length:181
Mass (Da):20,576
Last modified:November 1, 1995 - v2
Checksum:iEC5D8F065EEE2D9C
GO
Isoform 2 (identifier: P18847-2) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip

The sequence of this isoform differs from the canonical sequence as follows:
     116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:118
Mass (Da):13,266
Checksum:iE0444ABC236FA838
GO
Isoform 3 (identifier: P18847-3) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b

The sequence of this isoform differs from the canonical sequence as follows:
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
Show »
Length:135
Mass (Da):15,250
Checksum:i4A7AB87BE6374478
GO
Isoform 4 (identifier: P18847-4) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip2c

The sequence of this isoform differs from the canonical sequence as follows:
     14-42: Missing.
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Show »
Length:106
Mass (Da):12,261
Checksum:iC0BE4D381ECB1833
GO
Isoform 5 (identifier: P18847-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.

Show »
Length:124
Mass (Da):14,314
Checksum:i71BF35DFB32B5625
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti132I → L no nucleotide entry (PubMed:2516827).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04844238T → M1 PublicationCorresponds to variant dbSNP:rs11571541Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0469661 – 57Missing in isoform 5. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_04318214 – 42Missing in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000592116 – 181KESEK…GTLQS → LQY in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_043150117 – 181ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19871 mRNA Translation: AAA20506.1
AB066566 mRNA Translation: BAB84092.1
AB078026 mRNA Translation: BAC00495.1
AB078027 mRNA Translation: BAC00496.1
AY313927 mRNA Translation: AAP93896.1
BT006996 mRNA Translation: AAP35642.1
AY426987 Genomic DNA Translation: AAQ93358.1
AK312998 mRNA Translation: BAG35834.1
DA589280 mRNA No translation available.
CR450334 mRNA Translation: CAG29330.1
AC092803 Genomic DNA No translation available.
AL590648 Genomic DNA No translation available.
AL606913 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93385.1
CH471100 Genomic DNA Translation: EAW93386.1
CH471100 Genomic DNA Translation: EAW93387.1
CH471100 Genomic DNA Translation: EAW93388.1
BC006322 mRNA Translation: AAH06322.1
CCDSiCCDS1506.1 [P18847-1]
CCDS41464.1 [P18847-3]
CCDS55688.1 [P18847-4]
CCDS58059.1 [P18847-5]
PIRiA54025
B54025
C34223
RefSeqiNP_001025458.1, NM_001030287.3 [P18847-1]
NP_001035709.1, NM_001040619.2 [P18847-3]
NP_001193413.2, NM_001206484.2 [P18847-5]
NP_001193415.1, NM_001206486.2 [P18847-4]
NP_001193417.2, NM_001206488.2 [P18847-5]
NP_001665.1, NM_001674.3 [P18847-1]
XP_005273203.1, XM_005273146.1 [P18847-1]
XP_011507881.1, XM_011509579.1 [P18847-1]
UniGeneiHs.460

Genome annotation databases

EnsembliENST00000336937; ENSP00000336908; ENSG00000162772 [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772 [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772 [P18847-3]
ENST00000366987; ENSP00000355954; ENSG00000162772 [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772 [P18847-3]
ENST00000613104; ENSP00000480606; ENSG00000162772 [P18847-5]
ENST00000613954; ENSP00000483576; ENSG00000162772 [P18847-5]
GeneIDi467
KEGGihsa:467
UCSCiuc001hjf.4 human [P18847-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiATF3_HUMAN
AccessioniPrimary (citable) accession number: P18847
Secondary accession number(s): Q5VTZ2
, Q6ICQ9, Q7Z566, Q8WYM6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: November 1, 1995
Last modified: March 28, 2018
This is version 185 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health