Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P18847

- ATF3_HUMAN

UniProt

P18847 - ATF3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclic AMP-dependent transcription factor ATF-3

Gene

ATF3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

GO - Molecular functioni

  1. identical protein binding Source: IntAct
  2. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: Ensembl
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: Ensembl
  4. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
  5. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
  6. sequence-specific DNA binding transcription factor activity Source: ProtInc
  7. transcription corepressor activity Source: ProtInc

GO - Biological processi

  1. activation of signaling protein activity involved in unfolded protein response Source: Reactome
  2. cellular protein metabolic process Source: Reactome
  3. endoplasmic reticulum unfolded protein response Source: Reactome
  4. gluconeogenesis Source: Ensembl
  5. positive regulation of cell proliferation Source: Ensembl
  6. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  7. skeletal muscle cell differentiation Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiREACT_18355. ATF4 activates genes.
SignaLinkiP18847.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclic AMP-dependent transcription factor ATF-3
Short name:
cAMP-dependent transcription factor ATF-3
Alternative name(s):
Activating transcription factor 3
Gene namesi
Name:ATF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:785. ATF3.

Subcellular locationi

Nucleus 1 PublicationPROSITE-ProRule annotation

GO - Cellular componenti

  1. nucleolus Source: HPA
  2. nucleoplasm Source: Reactome
  3. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25085.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 181181Cyclic AMP-dependent transcription factor ATF-3PRO_0000076581Add
BLAST

Proteomic databases

MaxQBiP18847.
PaxDbiP18847.
PRIDEiP18847.

PTM databases

PhosphoSiteiP18847.

Expressioni

Gene expression databases

BgeeiP18847.
CleanExiHS_ATF3.
ExpressionAtlasiP18847. baseline and differential.
GenevestigatoriP18847.

Organism-specific databases

HPAiHPA001562.

Interactioni

Subunit structurei

Binds DNA as a homodimer or a heterodimer.

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-712767,EBI-712767
FHL2Q141923EBI-712767,EBI-701903
RELAQ042064EBI-712767,EBI-73886

Protein-protein interaction databases

BioGridi106957. 51 interactions.
DIPiDIP-254N.
DIP-344N.
IntActiP18847. 12 interactions.
MINTiMINT-4649546.
STRINGi9606.ENSP00000344352.

Structurei

3D structure databases

ProteinModelPortaliP18847.
SMRiP18847. Positions 87-149.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 14964bZIPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni88 – 11023Basic motifPROSITE-ProRule annotationAdd
BLAST
Regioni114 – 14229Leucine-zipperPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Curated
Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG242494.
GeneTreeiENSGT00730000110847.
HOGENOMiHOG000034126.
HOVERGENiHBG003381.
InParanoidiP18847.
KOiK09032.
OMAiADISCSA.
PhylomeDBiP18847.
TreeFamiTF326301.

Family and domain databases

InterProiIPR000837. AP-1.
IPR004827. bZIP.
[Graphical view]
PfamiPF00170. bZIP_1. 1 hit.
[Graphical view]
PRINTSiPR00042. LEUZIPPRFOS.
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEiPS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P18847-1) [UniParc]FASTAAdd to Basket

Also known as: ATF3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ
60 70 80 90 100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA
110 120 130 140 150
AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR
160 170 180
PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S
Length:181
Mass (Da):20,576
Last modified:November 1, 1995 - v2
Checksum:iEC5D8F065EEE2D9C
GO
Isoform 2 (identifier: P18847-2) [UniParc]FASTAAdd to Basket

Also known as: ATF3-delta-Zip

The sequence of this isoform differs from the canonical sequence as follows:
     116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:118
Mass (Da):13,266
Checksum:iE0444ABC236FA838
GO
Isoform 3 (identifier: P18847-3) [UniParc]FASTAAdd to Basket

Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b

The sequence of this isoform differs from the canonical sequence as follows:
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.

Show »
Length:135
Mass (Da):15,250
Checksum:i4A7AB87BE6374478
GO
Isoform 4 (identifier: P18847-4) [UniParc]FASTAAdd to Basket

Also known as: ATF3-delta-Zip2c

The sequence of this isoform differs from the canonical sequence as follows:
     14-42: Missing.
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Show »
Length:106
Mass (Da):12,261
Checksum:iC0BE4D381ECB1833
GO
Isoform 5 (identifier: P18847-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.

Show »
Length:124
Mass (Da):14,314
Checksum:i71BF35DFB32B5625
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti132 – 1321I → L no nucleotide entry (PubMed:2516827)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti38 – 381T → M.1 Publication
Corresponds to variant rs11571541 [ dbSNP | Ensembl ].
VAR_048442

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5757Missing in isoform 5. 1 PublicationVSP_046966Add
BLAST
Alternative sequencei14 – 4229Missing in isoform 4. 1 PublicationVSP_043182Add
BLAST
Alternative sequencei116 – 18166KESEK…GTLQS → LQY in isoform 2. 1 PublicationVSP_000592Add
BLAST
Alternative sequencei117 – 18165ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. 2 PublicationsVSP_043150Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19871 mRNA. Translation: AAA20506.1.
AB066566 mRNA. Translation: BAB84092.1.
AB078026 mRNA. Translation: BAC00495.1.
AB078027 mRNA. Translation: BAC00496.1.
AY313927 mRNA. Translation: AAP93896.1.
BT006996 mRNA. Translation: AAP35642.1.
AY426987 Genomic DNA. Translation: AAQ93358.1.
AK312998 mRNA. Translation: BAG35834.1.
DA589280 mRNA. No translation available.
CR450334 mRNA. Translation: CAG29330.1.
AC092803 Genomic DNA. No translation available.
AL590648 Genomic DNA. Translation: CAH72653.1.
AL590648 Genomic DNA. Translation: CAH72654.1.
AL590648 Genomic DNA. Translation: CAH72656.1.
AL606913 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93385.1.
CH471100 Genomic DNA. Translation: EAW93386.1.
CH471100 Genomic DNA. Translation: EAW93387.1.
CH471100 Genomic DNA. Translation: EAW93388.1.
BC006322 mRNA. Translation: AAH06322.1.
CCDSiCCDS1506.1. [P18847-1]
CCDS41464.1. [P18847-3]
CCDS55688.1. [P18847-4]
CCDS58059.1. [P18847-5]
PIRiA54025.
B54025.
C34223.
RefSeqiNP_001025458.1. NM_001030287.3. [P18847-1]
NP_001035709.1. NM_001040619.2. [P18847-3]
NP_001193413.2. NM_001206484.2. [P18847-5]
NP_001193415.1. NM_001206486.2. [P18847-4]
NP_001193417.2. NM_001206488.2. [P18847-5]
NP_001665.1. NM_001674.3. [P18847-1]
XP_005273203.1. XM_005273146.1. [P18847-1]
UniGeneiHs.460.

Genome annotation databases

EnsembliENST00000336937; ENSP00000336908; ENSG00000162772. [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772. [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772. [P18847-3]
ENST00000366987; ENSP00000355954; ENSG00000162772. [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772. [P18847-3]
ENST00000613104; ENSP00000480606; ENSG00000162772. [P18847-5]
ENST00000613954; ENSP00000483576; ENSG00000162772. [P18847-5]
GeneIDi467.
KEGGihsa:467.
UCSCiuc001hjf.3. human. [P18847-1]
uc001hji.3. human. [P18847-3]
uc021piv.1. human. [P18847-4]

Polymorphism databases

DMDMi1168543.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19871 mRNA. Translation: AAA20506.1 .
AB066566 mRNA. Translation: BAB84092.1 .
AB078026 mRNA. Translation: BAC00495.1 .
AB078027 mRNA. Translation: BAC00496.1 .
AY313927 mRNA. Translation: AAP93896.1 .
BT006996 mRNA. Translation: AAP35642.1 .
AY426987 Genomic DNA. Translation: AAQ93358.1 .
AK312998 mRNA. Translation: BAG35834.1 .
DA589280 mRNA. No translation available.
CR450334 mRNA. Translation: CAG29330.1 .
AC092803 Genomic DNA. No translation available.
AL590648 Genomic DNA. Translation: CAH72653.1 .
AL590648 Genomic DNA. Translation: CAH72654.1 .
AL590648 Genomic DNA. Translation: CAH72656.1 .
AL606913 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93385.1 .
CH471100 Genomic DNA. Translation: EAW93386.1 .
CH471100 Genomic DNA. Translation: EAW93387.1 .
CH471100 Genomic DNA. Translation: EAW93388.1 .
BC006322 mRNA. Translation: AAH06322.1 .
CCDSi CCDS1506.1. [P18847-1 ]
CCDS41464.1. [P18847-3 ]
CCDS55688.1. [P18847-4 ]
CCDS58059.1. [P18847-5 ]
PIRi A54025.
B54025.
C34223.
RefSeqi NP_001025458.1. NM_001030287.3. [P18847-1 ]
NP_001035709.1. NM_001040619.2. [P18847-3 ]
NP_001193413.2. NM_001206484.2. [P18847-5 ]
NP_001193415.1. NM_001206486.2. [P18847-4 ]
NP_001193417.2. NM_001206488.2. [P18847-5 ]
NP_001665.1. NM_001674.3. [P18847-1 ]
XP_005273203.1. XM_005273146.1. [P18847-1 ]
UniGenei Hs.460.

3D structure databases

ProteinModelPortali P18847.
SMRi P18847. Positions 87-149.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106957. 51 interactions.
DIPi DIP-254N.
DIP-344N.
IntActi P18847. 12 interactions.
MINTi MINT-4649546.
STRINGi 9606.ENSP00000344352.

Chemistry

DrugBanki DB00852. Pseudoephedrine.

PTM databases

PhosphoSitei P18847.

Polymorphism databases

DMDMi 1168543.

Proteomic databases

MaxQBi P18847.
PaxDbi P18847.
PRIDEi P18847.

Protocols and materials databases

DNASUi 467.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000336937 ; ENSP00000336908 ; ENSG00000162772 . [P18847-4 ]
ENST00000341491 ; ENSP00000344352 ; ENSG00000162772 . [P18847-1 ]
ENST00000366983 ; ENSP00000355950 ; ENSG00000162772 . [P18847-3 ]
ENST00000366987 ; ENSP00000355954 ; ENSG00000162772 . [P18847-1 ]
ENST00000464547 ; ENSP00000432208 ; ENSG00000162772 . [P18847-3 ]
ENST00000613104 ; ENSP00000480606 ; ENSG00000162772 . [P18847-5 ]
ENST00000613954 ; ENSP00000483576 ; ENSG00000162772 . [P18847-5 ]
GeneIDi 467.
KEGGi hsa:467.
UCSCi uc001hjf.3. human. [P18847-1 ]
uc001hji.3. human. [P18847-3 ]
uc021piv.1. human. [P18847-4 ]

Organism-specific databases

CTDi 467.
GeneCardsi GC01P212738.
HGNCi HGNC:785. ATF3.
HPAi HPA001562.
MIMi 603148. gene.
neXtProti NX_P18847.
PharmGKBi PA25085.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG242494.
GeneTreei ENSGT00730000110847.
HOGENOMi HOG000034126.
HOVERGENi HBG003381.
InParanoidi P18847.
KOi K09032.
OMAi ADISCSA.
PhylomeDBi P18847.
TreeFami TF326301.

Enzyme and pathway databases

Reactomei REACT_18355. ATF4 activates genes.
SignaLinki P18847.

Miscellaneous databases

ChiTaRSi ATF3. human.
GeneWikii ATF3.
GenomeRNAii 467.
NextBioi 1925.
PROi P18847.
SOURCEi Search...

Gene expression databases

Bgeei P18847.
CleanExi HS_ATF3.
ExpressionAtlasi P18847. baseline and differential.
Genevestigatori P18847.

Family and domain databases

InterProi IPR000837. AP-1.
IPR004827. bZIP.
[Graphical view ]
Pfami PF00170. bZIP_1. 1 hit.
[Graphical view ]
PRINTSi PR00042. LEUZIPPRFOS.
SMARTi SM00338. BRLZ. 1 hit.
[Graphical view ]
PROSITEi PS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms."
    Chen B.P.C., Liang G., Whelan J., Hai T.
    J. Biol. Chem. 269:15819-15826(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "An alternatively spliced isoform of transcriptional repressor ATF3 and its induction by stress stimuli."
    Hashimoto Y., Zhang C., Kawauchi J., Imoto I., Adachi M.T., Inazawa J., Amagasa T., Hai T., Kitajima S.
    Nucleic Acids Res. 30:2398-2406(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
  3. "Amino acid deprivation and endoplasmic reticulum stress induce expression of multiple activating transcription factor-3 mRNA species that, when overexpressed in HepG2 cells, modulate transcription by the human asparagine synthetase promoter."
    Pan Y., Chen H., Siu F., Kilberg M.S.
    J. Biol. Chem. 278:38402-38412(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
  4. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. NIEHS SNPs program
    Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-38.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-147 (ISOFORM 5).
    Tissue: Cerebellum and Lung.
  7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  8. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle.
  11. "Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers."
    Hai T., Liu F., Coukos W.J., Green M.R.
    Genes Dev. 3:2083-2090(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-181.
  12. Erratum
    Hai T., Liu F., Coukos W.J., Green M.R.
    Genes Dev. 4:682-682(1990)
  13. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

Entry informationi

Entry nameiATF3_HUMAN
AccessioniPrimary (citable) accession number: P18847
Secondary accession number(s): Q5VTZ2
, Q6ICQ9, Q7Z566, Q8WYM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: November 1, 1995
Last modified: October 29, 2014
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3