Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P18847

- ATF3_HUMAN

UniProt

P18847 - ATF3_HUMAN

Protein

Cyclic AMP-dependent transcription factor ATF-3

Gene

ATF3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 2 (01 Nov 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

    GO - Molecular functioni

    1. identical protein binding Source: IntAct
    2. protein binding Source: IntAct
    3. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
    4. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
    5. sequence-specific DNA binding transcription factor activity Source: ProtInc
    6. transcription corepressor activity Source: ProtInc

    GO - Biological processi

    1. activation of signaling protein activity involved in unfolded protein response Source: Reactome
    2. cellular protein metabolic process Source: Reactome
    3. endoplasmic reticulum unfolded protein response Source: Reactome
    4. gluconeogenesis Source: Ensembl
    5. negative regulation of transcription, DNA-templated Source: Ensembl
    6. positive regulation of cell proliferation Source: Ensembl
    7. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
    8. skeletal muscle cell differentiation Source: Ensembl

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_18355. ATF4 activates genes.
    SignaLinkiP18847.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclic AMP-dependent transcription factor ATF-3
    Short name:
    cAMP-dependent transcription factor ATF-3
    Alternative name(s):
    Activating transcription factor 3
    Gene namesi
    Name:ATF3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:785. ATF3.

    Subcellular locationi

    Nucleus 1 PublicationPROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleolus Source: HPA
    2. nucleoplasm Source: Reactome
    3. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25085.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 181181Cyclic AMP-dependent transcription factor ATF-3PRO_0000076581Add
    BLAST

    Proteomic databases

    MaxQBiP18847.
    PaxDbiP18847.
    PRIDEiP18847.

    PTM databases

    PhosphoSiteiP18847.

    Expressioni

    Gene expression databases

    ArrayExpressiP18847.
    BgeeiP18847.
    CleanExiHS_ATF3.
    GenevestigatoriP18847.

    Organism-specific databases

    HPAiHPA001562.

    Interactioni

    Subunit structurei

    Binds DNA as a homodimer or a heterodimer.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-712767,EBI-712767
    FHL2Q141923EBI-712767,EBI-701903
    RELAQ042064EBI-712767,EBI-73886

    Protein-protein interaction databases

    BioGridi106957. 51 interactions.
    DIPiDIP-254N.
    DIP-344N.
    IntActiP18847. 12 interactions.
    MINTiMINT-4649546.
    STRINGi9606.ENSP00000344352.

    Structurei

    3D structure databases

    ProteinModelPortaliP18847.
    SMRiP18847. Positions 87-149.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini86 – 14964bZIPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni88 – 11023Basic motifPROSITE-ProRule annotationAdd
    BLAST
    Regioni114 – 14229Leucine-zipperPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the bZIP family. ATF subfamily.Curated
    Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG242494.
    HOGENOMiHOG000034126.
    HOVERGENiHBG003381.
    InParanoidiP18847.
    KOiK09032.
    OMAiADISCSA.
    PhylomeDBiP18847.
    TreeFamiTF326301.

    Family and domain databases

    InterProiIPR004827. bZIP.
    IPR000837. Leuzip_Fos.
    [Graphical view]
    PfamiPF00170. bZIP_1. 1 hit.
    [Graphical view]
    PRINTSiPR00042. LEUZIPPRFOS.
    SMARTiSM00338. BRLZ. 1 hit.
    [Graphical view]
    PROSITEiPS50217. BZIP. 1 hit.
    PS00036. BZIP_BASIC. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P18847-1) [UniParc]FASTAAdd to Basket

    Also known as: ATF3

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ    50
    NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA 100
    AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR 150
    PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S 181
    Length:181
    Mass (Da):20,576
    Last modified:November 1, 1995 - v2
    Checksum:iEC5D8F065EEE2D9C
    GO
    Isoform 2 (identifier: P18847-2) [UniParc]FASTAAdd to Basket

    Also known as: ATF3-delta-Zip

    The sequence of this isoform differs from the canonical sequence as follows:
         116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:118
    Mass (Da):13,266
    Checksum:iE0444ABC236FA838
    GO
    Isoform 3 (identifier: P18847-3) [UniParc]FASTAAdd to Basket

    Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b

    The sequence of this isoform differs from the canonical sequence as follows:
         117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

    Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.

    Show »
    Length:135
    Mass (Da):15,250
    Checksum:i4A7AB87BE6374478
    GO
    Isoform 4 (identifier: P18847-4) [UniParc]FASTAAdd to Basket

    Also known as: ATF3-delta-Zip2c

    The sequence of this isoform differs from the canonical sequence as follows:
         14-42: Missing.
         117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

    Show »
    Length:106
    Mass (Da):12,261
    Checksum:iC0BE4D381ECB1833
    GO
    Isoform 5 (identifier: P18847-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-57: Missing.

    Show »
    Length:124
    Mass (Da):14,314
    Checksum:i71BF35DFB32B5625
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti132 – 1321I → L no nucleotide entry (PubMed:2516827)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti38 – 381T → M.1 Publication
    Corresponds to variant rs11571541 [ dbSNP | Ensembl ].
    VAR_048442

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5757Missing in isoform 5. 1 PublicationVSP_046966Add
    BLAST
    Alternative sequencei14 – 4229Missing in isoform 4. 1 PublicationVSP_043182Add
    BLAST
    Alternative sequencei116 – 18166KESEK…GTLQS → LQY in isoform 2. 1 PublicationVSP_000592Add
    BLAST
    Alternative sequencei117 – 18165ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. 2 PublicationsVSP_043150Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L19871 mRNA. Translation: AAA20506.1.
    AB066566 mRNA. Translation: BAB84092.1.
    AB078026 mRNA. Translation: BAC00495.1.
    AB078027 mRNA. Translation: BAC00496.1.
    AY313927 mRNA. Translation: AAP93896.1.
    BT006996 mRNA. Translation: AAP35642.1.
    AY426987 Genomic DNA. Translation: AAQ93358.1.
    AK312998 mRNA. Translation: BAG35834.1.
    DA589280 mRNA. No translation available.
    CR450334 mRNA. Translation: CAG29330.1.
    AC092803 Genomic DNA. No translation available.
    AL590648 Genomic DNA. Translation: CAH72653.1.
    AL590648 Genomic DNA. Translation: CAH72654.1.
    AL590648 Genomic DNA. Translation: CAH72656.1.
    AL606913 Genomic DNA. No translation available.
    CH471100 Genomic DNA. Translation: EAW93385.1.
    CH471100 Genomic DNA. Translation: EAW93386.1.
    CH471100 Genomic DNA. Translation: EAW93387.1.
    CH471100 Genomic DNA. Translation: EAW93388.1.
    BC006322 mRNA. Translation: AAH06322.1.
    CCDSiCCDS1506.1. [P18847-1]
    CCDS41464.1. [P18847-3]
    CCDS55688.1. [P18847-4]
    CCDS58059.1. [P18847-5]
    PIRiA54025.
    B54025.
    C34223.
    RefSeqiNP_001025458.1. NM_001030287.3. [P18847-1]
    NP_001035709.1. NM_001040619.2. [P18847-3]
    NP_001193413.2. NM_001206484.2. [P18847-5]
    NP_001193415.1. NM_001206486.2. [P18847-4]
    NP_001193417.2. NM_001206488.2. [P18847-5]
    NP_001665.1. NM_001674.3. [P18847-1]
    XP_005273203.1. XM_005273146.1. [P18847-1]
    UniGeneiHs.460.

    Genome annotation databases

    EnsembliENST00000336937; ENSP00000336908; ENSG00000162772. [P18847-4]
    ENST00000341491; ENSP00000344352; ENSG00000162772. [P18847-1]
    ENST00000366983; ENSP00000355950; ENSG00000162772. [P18847-3]
    ENST00000366985; ENSP00000355952; ENSG00000162772. [P18847-5]
    ENST00000366987; ENSP00000355954; ENSG00000162772. [P18847-1]
    ENST00000464547; ENSP00000432208; ENSG00000162772. [P18847-3]
    GeneIDi467.
    KEGGihsa:467.
    UCSCiuc001hjf.3. human. [P18847-1]
    uc001hji.3. human. [P18847-3]
    uc021piv.1. human. [P18847-4]

    Polymorphism databases

    DMDMi1168543.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs
    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L19871 mRNA. Translation: AAA20506.1 .
    AB066566 mRNA. Translation: BAB84092.1 .
    AB078026 mRNA. Translation: BAC00495.1 .
    AB078027 mRNA. Translation: BAC00496.1 .
    AY313927 mRNA. Translation: AAP93896.1 .
    BT006996 mRNA. Translation: AAP35642.1 .
    AY426987 Genomic DNA. Translation: AAQ93358.1 .
    AK312998 mRNA. Translation: BAG35834.1 .
    DA589280 mRNA. No translation available.
    CR450334 mRNA. Translation: CAG29330.1 .
    AC092803 Genomic DNA. No translation available.
    AL590648 Genomic DNA. Translation: CAH72653.1 .
    AL590648 Genomic DNA. Translation: CAH72654.1 .
    AL590648 Genomic DNA. Translation: CAH72656.1 .
    AL606913 Genomic DNA. No translation available.
    CH471100 Genomic DNA. Translation: EAW93385.1 .
    CH471100 Genomic DNA. Translation: EAW93386.1 .
    CH471100 Genomic DNA. Translation: EAW93387.1 .
    CH471100 Genomic DNA. Translation: EAW93388.1 .
    BC006322 mRNA. Translation: AAH06322.1 .
    CCDSi CCDS1506.1. [P18847-1 ]
    CCDS41464.1. [P18847-3 ]
    CCDS55688.1. [P18847-4 ]
    CCDS58059.1. [P18847-5 ]
    PIRi A54025.
    B54025.
    C34223.
    RefSeqi NP_001025458.1. NM_001030287.3. [P18847-1 ]
    NP_001035709.1. NM_001040619.2. [P18847-3 ]
    NP_001193413.2. NM_001206484.2. [P18847-5 ]
    NP_001193415.1. NM_001206486.2. [P18847-4 ]
    NP_001193417.2. NM_001206488.2. [P18847-5 ]
    NP_001665.1. NM_001674.3. [P18847-1 ]
    XP_005273203.1. XM_005273146.1. [P18847-1 ]
    UniGenei Hs.460.

    3D structure databases

    ProteinModelPortali P18847.
    SMRi P18847. Positions 87-149.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106957. 51 interactions.
    DIPi DIP-254N.
    DIP-344N.
    IntActi P18847. 12 interactions.
    MINTi MINT-4649546.
    STRINGi 9606.ENSP00000344352.

    Chemistry

    DrugBanki DB00852. Pseudoephedrine.

    PTM databases

    PhosphoSitei P18847.

    Polymorphism databases

    DMDMi 1168543.

    Proteomic databases

    MaxQBi P18847.
    PaxDbi P18847.
    PRIDEi P18847.

    Protocols and materials databases

    DNASUi 467.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000336937 ; ENSP00000336908 ; ENSG00000162772 . [P18847-4 ]
    ENST00000341491 ; ENSP00000344352 ; ENSG00000162772 . [P18847-1 ]
    ENST00000366983 ; ENSP00000355950 ; ENSG00000162772 . [P18847-3 ]
    ENST00000366985 ; ENSP00000355952 ; ENSG00000162772 . [P18847-5 ]
    ENST00000366987 ; ENSP00000355954 ; ENSG00000162772 . [P18847-1 ]
    ENST00000464547 ; ENSP00000432208 ; ENSG00000162772 . [P18847-3 ]
    GeneIDi 467.
    KEGGi hsa:467.
    UCSCi uc001hjf.3. human. [P18847-1 ]
    uc001hji.3. human. [P18847-3 ]
    uc021piv.1. human. [P18847-4 ]

    Organism-specific databases

    CTDi 467.
    GeneCardsi GC01P212738.
    HGNCi HGNC:785. ATF3.
    HPAi HPA001562.
    MIMi 603148. gene.
    neXtProti NX_P18847.
    PharmGKBi PA25085.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG242494.
    HOGENOMi HOG000034126.
    HOVERGENi HBG003381.
    InParanoidi P18847.
    KOi K09032.
    OMAi ADISCSA.
    PhylomeDBi P18847.
    TreeFami TF326301.

    Enzyme and pathway databases

    Reactomei REACT_18355. ATF4 activates genes.
    SignaLinki P18847.

    Miscellaneous databases

    ChiTaRSi ATF3. human.
    GeneWikii ATF3.
    GenomeRNAii 467.
    NextBioi 1925.
    PROi P18847.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P18847.
    Bgeei P18847.
    CleanExi HS_ATF3.
    Genevestigatori P18847.

    Family and domain databases

    InterProi IPR004827. bZIP.
    IPR000837. Leuzip_Fos.
    [Graphical view ]
    Pfami PF00170. bZIP_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00042. LEUZIPPRFOS.
    SMARTi SM00338. BRLZ. 1 hit.
    [Graphical view ]
    PROSITEi PS50217. BZIP. 1 hit.
    PS00036. BZIP_BASIC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms."
      Chen B.P.C., Liang G., Whelan J., Hai T.
      J. Biol. Chem. 269:15819-15826(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "An alternatively spliced isoform of transcriptional repressor ATF3 and its induction by stress stimuli."
      Hashimoto Y., Zhang C., Kawauchi J., Imoto I., Adachi M.T., Inazawa J., Amagasa T., Hai T., Kitajima S.
      Nucleic Acids Res. 30:2398-2406(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
    3. "Amino acid deprivation and endoplasmic reticulum stress induce expression of multiple activating transcription factor-3 mRNA species that, when overexpressed in HepG2 cells, modulate transcription by the human asparagine synthetase promoter."
      Pan Y., Chen H., Siu F., Kilberg M.S.
      J. Biol. Chem. 278:38402-38412(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
    4. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. NIEHS SNPs program
      Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-38.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-147 (ISOFORM 5).
      Tissue: Cerebellum and Lung.
    7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    8. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Muscle.
    11. "Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers."
      Hai T., Liu F., Coukos W.J., Green M.R.
      Genes Dev. 3:2083-2090(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-181.
    12. Erratum
      Hai T., Liu F., Coukos W.J., Green M.R.
      Genes Dev. 4:682-682(1990)
    13. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).

    Entry informationi

    Entry nameiATF3_HUMAN
    AccessioniPrimary (citable) accession number: P18847
    Secondary accession number(s): Q5VTZ2
    , Q6ICQ9, Q7Z566, Q8WYM6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1990
    Last sequence update: November 1, 1995
    Last modified: October 1, 2014
    This is version 151 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3