Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P18847 (ATF3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 149. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclic AMP-dependent transcription factor ATF-3

Short name=cAMP-dependent transcription factor ATF-3
Alternative name(s):
Activating transcription factor 3
Gene names
Name:ATF3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length181 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

Subunit structure

Binds DNA as a homodimer or a heterodimer.

Subcellular location

Nucleus Ref.2.

Sequence similarities

Belongs to the bZIP family. ATF subfamily.

Contains 1 bZIP (basic-leucine zipper) domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandDNA-binding
   Molecular functionRepressor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processactivation of signaling protein activity involved in unfolded protein response

Traceable author statement. Source: Reactome

cellular protein metabolic process

Traceable author statement. Source: Reactome

endoplasmic reticulum unfolded protein response

Traceable author statement. Source: Reactome

gluconeogenesis

Inferred from electronic annotation. Source: Ensembl

negative regulation of transcription, DNA-templated

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell proliferation

Inferred from electronic annotation. Source: Ensembl

skeletal muscle cell differentiation

Inferred from electronic annotation. Source: Ensembl

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleolus

Inferred from direct assay. Source: HPA

nucleoplasm

Traceable author statement. Source: Reactome

nucleus

Inferred from direct assay. Source: HPA

   Molecular_functionidentical protein binding

Inferred from physical interaction PubMed 18255255. Source: IntAct

protein binding

Inferred from physical interaction PubMed 16291753PubMed 18255255. Source: IntAct

sequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Traceable author statement Ref.1. Source: ProtInc

transcription corepressor activity

Traceable author statement Ref.1. Source: ProtInc

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P18847-1)

Also known as: ATF3;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P18847-2)

Also known as: ATF3-delta-Zip;

The sequence of this isoform differs from the canonical sequence as follows:
     116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 3 (identifier: P18847-3)

Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b;

The sequence of this isoform differs from the canonical sequence as follows:
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK
Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
Isoform 4 (identifier: P18847-4)

Also known as: ATF3-delta-Zip2c;

The sequence of this isoform differs from the canonical sequence as follows:
     14-42: Missing.
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK
Isoform 5 (identifier: P18847-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 181181Cyclic AMP-dependent transcription factor ATF-3
PRO_0000076581

Regions

Domain86 – 14964bZIP
Region88 – 11023Basic motif By similarity
Region114 – 14229Leucine-zipper By similarity

Natural variations

Alternative sequence1 – 5757Missing in isoform 5.
VSP_046966
Alternative sequence14 – 4229Missing in isoform 4.
VSP_043182
Alternative sequence116 – 18166KESEK…GTLQS → LQY in isoform 2.
VSP_000592
Alternative sequence117 – 18165ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4.
VSP_043150
Natural variant381T → M. Ref.5
Corresponds to variant rs11571541 [ dbSNP | Ensembl ].
VAR_048442

Experimental info

Sequence conflict1321I → L no nucleotide entry Ref.11

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (ATF3) [UniParc].

Last modified November 1, 1995. Version 2.
Checksum: EC5D8F065EEE2D9C

FASTA18120,576
        10         20         30         40         50         60 
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ NKHLCHRMSS 

        70         80         90        100        110        120 
ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA AKCRNKKKEK TECLQKESEK 

       130        140        150        160        170        180 
LESVNAELKA QIEELKNEKQ HLIYMLNLHR PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ 


S 

« Hide

Isoform 2 (ATF3-delta-Zip) [UniParc].

Checksum: E0444ABC236FA838
Show »

FASTA11813,266
Isoform 3 (ATF3-delta-Zip2a/TF3-delta-Zip2b) [UniParc].

Checksum: 4A7AB87BE6374478
Show »

FASTA13515,250
Isoform 4 (ATF3-delta-Zip2c) [UniParc].

Checksum: C0BE4D381ECB1833
Show »

FASTA10612,261
Isoform 5 [UniParc].

Checksum: 71BF35DFB32B5625
Show »

FASTA12414,314

References

« Hide 'large scale' references
[1]"ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms."
Chen B.P.C., Liang G., Whelan J., Hai T.
J. Biol. Chem. 269:15819-15826(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[2]"An alternatively spliced isoform of transcriptional repressor ATF3 and its induction by stress stimuli."
Hashimoto Y., Zhang C., Kawauchi J., Imoto I., Adachi M.T., Inazawa J., Amagasa T., Hai T., Kitajima S.
Nucleic Acids Res. 30:2398-2406(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING.
[3]"Amino acid deprivation and endoplasmic reticulum stress induce expression of multiple activating transcription factor-3 mRNA species that, when overexpressed in HepG2 cells, modulate transcription by the human asparagine synthetase promoter."
Pan Y., Chen H., Siu F., Kilberg M.S.
J. Biol. Chem. 278:38402-38412(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING.
[4]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[5]NIEHS SNPs program
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-38.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-147 (ISOFORM 5).
Tissue: Cerebellum and Lung.
[7]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[8]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Muscle.
[11]"Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers."
Hai T., Liu F., Coukos W.J., Green M.R.
Genes Dev. 3:2083-2090(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-181.
[12]Erratum
Hai T., Liu F., Coukos W.J., Green M.R.
Genes Dev. 4:682-682(1990)
[13]"An unappreciated role for RNA surveillance."
Hillman R.T., Green R.E., Brenner S.E.
Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L19871 mRNA. Translation: AAA20506.1.
AB066566 mRNA. Translation: BAB84092.1.
AB078026 mRNA. Translation: BAC00495.1.
AB078027 mRNA. Translation: BAC00496.1.
AY313927 mRNA. Translation: AAP93896.1.
BT006996 mRNA. Translation: AAP35642.1.
AY426987 Genomic DNA. Translation: AAQ93358.1.
AK312998 mRNA. Translation: BAG35834.1.
DA589280 mRNA. No translation available.
CR450334 mRNA. Translation: CAG29330.1.
AC092803 Genomic DNA. No translation available.
AL590648 Genomic DNA. Translation: CAH72653.1.
AL590648 Genomic DNA. Translation: CAH72654.1.
AL590648 Genomic DNA. Translation: CAH72656.1.
AL606913 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93385.1.
CH471100 Genomic DNA. Translation: EAW93386.1.
CH471100 Genomic DNA. Translation: EAW93387.1.
CH471100 Genomic DNA. Translation: EAW93388.1.
BC006322 mRNA. Translation: AAH06322.1.
CCDSCCDS1506.1. [P18847-1]
CCDS41464.1. [P18847-3]
CCDS55688.1. [P18847-4]
CCDS58059.1. [P18847-5]
PIRA54025.
B54025.
C34223.
RefSeqNP_001025458.1. NM_001030287.3. [P18847-1]
NP_001035709.1. NM_001040619.2. [P18847-3]
NP_001193413.2. NM_001206484.2. [P18847-5]
NP_001193415.1. NM_001206486.2. [P18847-4]
NP_001193417.2. NM_001206488.2. [P18847-5]
NP_001665.1. NM_001674.3. [P18847-1]
XP_005273203.1. XM_005273146.1. [P18847-1]
UniGeneHs.460.

3D structure databases

ProteinModelPortalP18847.
SMRP18847. Positions 87-149.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid106957. 51 interactions.
DIPDIP-254N.
DIP-344N.
IntActP18847. 12 interactions.
MINTMINT-4649546.
STRING9606.ENSP00000344352.

PTM databases

PhosphoSiteP18847.

Polymorphism databases

DMDM1168543.

Proteomic databases

MaxQBP18847.
PaxDbP18847.
PRIDEP18847.

Protocols and materials databases

DNASU467.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000336937; ENSP00000336908; ENSG00000162772. [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772. [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772. [P18847-3]
ENST00000366985; ENSP00000355952; ENSG00000162772. [P18847-5]
ENST00000366987; ENSP00000355954; ENSG00000162772. [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772. [P18847-3]
GeneID467.
KEGGhsa:467.
UCSCuc001hjf.3. human. [P18847-1]
uc001hji.3. human. [P18847-3]
uc021piv.1. human. [P18847-4]

Organism-specific databases

CTD467.
GeneCardsGC01P212738.
HGNCHGNC:785. ATF3.
HPAHPA001562.
MIM603148. gene.
neXtProtNX_P18847.
PharmGKBPA25085.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG242494.
HOGENOMHOG000034126.
HOVERGENHBG003381.
InParanoidP18847.
KOK09032.
OMAADISCSA.
PhylomeDBP18847.
TreeFamTF326301.

Enzyme and pathway databases

ReactomeREACT_17015. Metabolism of proteins.
SignaLinkP18847.

Gene expression databases

ArrayExpressP18847.
BgeeP18847.
CleanExHS_ATF3.
GenevestigatorP18847.

Family and domain databases

InterProIPR004827. bZIP.
IPR000837. Leuzip_Fos.
[Graphical view]
PfamPF00170. bZIP_1. 1 hit.
[Graphical view]
PRINTSPR00042. LEUZIPPRFOS.
SMARTSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEPS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSATF3. human.
GeneWikiATF3.
GenomeRNAi467.
NextBio1925.
PROP18847.
SOURCESearch...

Entry information

Entry nameATF3_HUMAN
AccessionPrimary (citable) accession number: P18847
Secondary accession number(s): Q5VTZ2 expand/collapse secondary AC list , Q6ICQ9, Q7Z566, Q8WYM6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: November 1, 1995
Last modified: July 9, 2014
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM