Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclic AMP-dependent transcription factor ATF-3

Gene

ATF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162772-MONOMER.
ReactomeiR-HSA-380994. ATF4 activates genes.
SignaLinkiP18847.
SIGNORiP18847.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclic AMP-dependent transcription factor ATF-3
Short name:
cAMP-dependent transcription factor ATF-3
Alternative name(s):
Activating transcription factor 3
Gene namesi
Name:ATF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:785. ATF3.

Subcellular locationi

GO - Cellular componenti

  • CHOP-ATF3 complex Source: ParkinsonsUK-UCL
  • nucleolus Source: HPA
  • nucleoplasm Source: Reactome
  • nucleus Source: ParkinsonsUK-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi467.
OpenTargetsiENSG00000162772.
PharmGKBiPA25085.

Chemistry databases

DrugBankiDB00852. Pseudoephedrine.

Polymorphism and mutation databases

BioMutaiATF3.
DMDMi1168543.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000765811 – 181Cyclic AMP-dependent transcription factor ATF-3Add BLAST181

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei162PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP18847.
PaxDbiP18847.
PeptideAtlasiP18847.
PRIDEiP18847.
TopDownProteomicsiP18847-1. [P18847-1]

PTM databases

iPTMnetiP18847.
PhosphoSitePlusiP18847.

Expressioni

Gene expression databases

BgeeiENSG00000162772.
CleanExiHS_ATF3.
ExpressionAtlasiP18847. baseline and differential.
GenevisibleiP18847. HS.

Organism-specific databases

HPAiHPA001562.

Interactioni

Subunit structurei

Binds DNA as a homodimer or a heterodimer.

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-712767,EBI-712767
ATF2P153362EBI-712767,EBI-1170906
ATF4P188482EBI-712767,EBI-492498
ATF7P175442EBI-712767,EBI-765623
BATF3Q9NR552EBI-712767,EBI-10312707
CEBPGP535672EBI-712767,EBI-740209
DDIT3P356384EBI-712767,EBI-742651
FHL2Q141923EBI-712767,EBI-701903
JUNP054127EBI-712767,EBI-852823
JUNBP172752EBI-712767,EBI-748062
JUNDP175352EBI-712767,EBI-2682803
NFATC1O956442EBI-712767,EBI-6907210
RELAQ042065EBI-9844134,EBI-73886

GO - Molecular functioni

  • protein heterodimerization activity Source: ParkinsonsUK-UCL
  • protein homodimerization activity Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi106957. 59 interactors.
DIPiDIP-254N.
DIP-344N.
IntActiP18847. 34 interactors.
MINTiMINT-4649546.
STRINGi9606.ENSP00000344352.

Structurei

3D structure databases

ProteinModelPortaliP18847.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini86 – 149bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni88 – 110Basic motifPROSITE-ProRule annotationAdd BLAST23
Regioni114 – 142Leucine-zipperPROSITE-ProRule annotationAdd BLAST29

Sequence similaritiesi

Belongs to the bZIP family. ATF subfamily.Curated
Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1414. Eukaryota.
ENOG4111CH5. LUCA.
GeneTreeiENSGT00730000110847.
HOGENOMiHOG000034126.
HOVERGENiHBG003381.
InParanoidiP18847.
KOiK09032.
OMAiMKAEVAP.
OrthoDBiEOG091G0M4N.
PhylomeDBiP18847.
TreeFamiTF326301.

Family and domain databases

InterProiIPR000837. AP-1.
IPR029812. ATF3.
IPR004827. bZIP.
[Graphical view]
PANTHERiPTHR23351. PTHR23351. 1 hit.
PTHR23351:SF23. PTHR23351:SF23. 1 hit.
PfamiPF00170. bZIP_1. 1 hit.
[Graphical view]
PRINTSiPR00042. LEUZIPPRFOS.
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEiPS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P18847-1) [UniParc]FASTAAdd to basket
Also known as: ATF3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ
60 70 80 90 100
NKHLCHRMSS ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA
110 120 130 140 150
AKCRNKKKEK TECLQKESEK LESVNAELKA QIEELKNEKQ HLIYMLNLHR
160 170 180
PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ S
Length:181
Mass (Da):20,576
Last modified:November 1, 1995 - v2
Checksum:iEC5D8F065EEE2D9C
GO
Isoform 2 (identifier: P18847-2) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip

The sequence of this isoform differs from the canonical sequence as follows:
     116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:118
Mass (Da):13,266
Checksum:iE0444ABC236FA838
GO
Isoform 3 (identifier: P18847-3) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b

The sequence of this isoform differs from the canonical sequence as follows:
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
Show »
Length:135
Mass (Da):15,250
Checksum:i4A7AB87BE6374478
GO
Isoform 4 (identifier: P18847-4) [UniParc]FASTAAdd to basket
Also known as: ATF3-delta-Zip2c

The sequence of this isoform differs from the canonical sequence as follows:
     14-42: Missing.
     117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK

Show »
Length:106
Mass (Da):12,261
Checksum:iC0BE4D381ECB1833
GO
Isoform 5 (identifier: P18847-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.

Show »
Length:124
Mass (Da):14,314
Checksum:i71BF35DFB32B5625
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti132I → L no nucleotide entry (PubMed:2516827).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04844238T → M.1 PublicationCorresponds to variant rs11571541dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0469661 – 57Missing in isoform 5. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_04318214 – 42Missing in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000592116 – 181KESEK…GTLQS → LQY in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_043150117 – 181ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19871 mRNA. Translation: AAA20506.1.
AB066566 mRNA. Translation: BAB84092.1.
AB078026 mRNA. Translation: BAC00495.1.
AB078027 mRNA. Translation: BAC00496.1.
AY313927 mRNA. Translation: AAP93896.1.
BT006996 mRNA. Translation: AAP35642.1.
AY426987 Genomic DNA. Translation: AAQ93358.1.
AK312998 mRNA. Translation: BAG35834.1.
DA589280 mRNA. No translation available.
CR450334 mRNA. Translation: CAG29330.1.
AC092803 Genomic DNA. No translation available.
AL590648 Genomic DNA. Translation: CAH72653.1.
AL590648 Genomic DNA. Translation: CAH72654.1.
AL590648 Genomic DNA. Translation: CAH72656.1.
AL606913 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93385.1.
CH471100 Genomic DNA. Translation: EAW93386.1.
CH471100 Genomic DNA. Translation: EAW93387.1.
CH471100 Genomic DNA. Translation: EAW93388.1.
BC006322 mRNA. Translation: AAH06322.1.
CCDSiCCDS1506.1. [P18847-1]
CCDS41464.1. [P18847-3]
CCDS55688.1. [P18847-4]
CCDS58059.1. [P18847-5]
PIRiA54025.
B54025.
C34223.
RefSeqiNP_001025458.1. NM_001030287.3. [P18847-1]
NP_001035709.1. NM_001040619.2. [P18847-3]
NP_001193413.2. NM_001206484.2. [P18847-5]
NP_001193415.1. NM_001206486.2. [P18847-4]
NP_001193417.2. NM_001206488.2. [P18847-5]
NP_001665.1. NM_001674.3. [P18847-1]
XP_005273203.1. XM_005273146.1. [P18847-1]
XP_011507881.1. XM_011509579.1. [P18847-1]
UniGeneiHs.460.

Genome annotation databases

EnsembliENST00000336937; ENSP00000336908; ENSG00000162772. [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772. [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772. [P18847-3]
ENST00000366987; ENSP00000355954; ENSG00000162772. [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772. [P18847-3]
ENST00000613104; ENSP00000480606; ENSG00000162772. [P18847-5]
ENST00000613954; ENSP00000483576; ENSG00000162772. [P18847-5]
GeneIDi467.
KEGGihsa:467.
UCSCiuc001hjf.4. human. [P18847-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19871 mRNA. Translation: AAA20506.1.
AB066566 mRNA. Translation: BAB84092.1.
AB078026 mRNA. Translation: BAC00495.1.
AB078027 mRNA. Translation: BAC00496.1.
AY313927 mRNA. Translation: AAP93896.1.
BT006996 mRNA. Translation: AAP35642.1.
AY426987 Genomic DNA. Translation: AAQ93358.1.
AK312998 mRNA. Translation: BAG35834.1.
DA589280 mRNA. No translation available.
CR450334 mRNA. Translation: CAG29330.1.
AC092803 Genomic DNA. No translation available.
AL590648 Genomic DNA. Translation: CAH72653.1.
AL590648 Genomic DNA. Translation: CAH72654.1.
AL590648 Genomic DNA. Translation: CAH72656.1.
AL606913 Genomic DNA. No translation available.
CH471100 Genomic DNA. Translation: EAW93385.1.
CH471100 Genomic DNA. Translation: EAW93386.1.
CH471100 Genomic DNA. Translation: EAW93387.1.
CH471100 Genomic DNA. Translation: EAW93388.1.
BC006322 mRNA. Translation: AAH06322.1.
CCDSiCCDS1506.1. [P18847-1]
CCDS41464.1. [P18847-3]
CCDS55688.1. [P18847-4]
CCDS58059.1. [P18847-5]
PIRiA54025.
B54025.
C34223.
RefSeqiNP_001025458.1. NM_001030287.3. [P18847-1]
NP_001035709.1. NM_001040619.2. [P18847-3]
NP_001193413.2. NM_001206484.2. [P18847-5]
NP_001193415.1. NM_001206486.2. [P18847-4]
NP_001193417.2. NM_001206488.2. [P18847-5]
NP_001665.1. NM_001674.3. [P18847-1]
XP_005273203.1. XM_005273146.1. [P18847-1]
XP_011507881.1. XM_011509579.1. [P18847-1]
UniGeneiHs.460.

3D structure databases

ProteinModelPortaliP18847.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106957. 59 interactors.
DIPiDIP-254N.
DIP-344N.
IntActiP18847. 34 interactors.
MINTiMINT-4649546.
STRINGi9606.ENSP00000344352.

Chemistry databases

DrugBankiDB00852. Pseudoephedrine.

PTM databases

iPTMnetiP18847.
PhosphoSitePlusiP18847.

Polymorphism and mutation databases

BioMutaiATF3.
DMDMi1168543.

Proteomic databases

EPDiP18847.
PaxDbiP18847.
PeptideAtlasiP18847.
PRIDEiP18847.
TopDownProteomicsiP18847-1. [P18847-1]

Protocols and materials databases

DNASUi467.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000336937; ENSP00000336908; ENSG00000162772. [P18847-4]
ENST00000341491; ENSP00000344352; ENSG00000162772. [P18847-1]
ENST00000366983; ENSP00000355950; ENSG00000162772. [P18847-3]
ENST00000366987; ENSP00000355954; ENSG00000162772. [P18847-1]
ENST00000464547; ENSP00000432208; ENSG00000162772. [P18847-3]
ENST00000613104; ENSP00000480606; ENSG00000162772. [P18847-5]
ENST00000613954; ENSP00000483576; ENSG00000162772. [P18847-5]
GeneIDi467.
KEGGihsa:467.
UCSCiuc001hjf.4. human. [P18847-1]

Organism-specific databases

CTDi467.
DisGeNETi467.
GeneCardsiATF3.
HGNCiHGNC:785. ATF3.
HPAiHPA001562.
MIMi603148. gene.
neXtProtiNX_P18847.
OpenTargetsiENSG00000162772.
PharmGKBiPA25085.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1414. Eukaryota.
ENOG4111CH5. LUCA.
GeneTreeiENSGT00730000110847.
HOGENOMiHOG000034126.
HOVERGENiHBG003381.
InParanoidiP18847.
KOiK09032.
OMAiMKAEVAP.
OrthoDBiEOG091G0M4N.
PhylomeDBiP18847.
TreeFamiTF326301.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162772-MONOMER.
ReactomeiR-HSA-380994. ATF4 activates genes.
SignaLinkiP18847.
SIGNORiP18847.

Miscellaneous databases

ChiTaRSiATF3. human.
GeneWikiiATF3.
GenomeRNAii467.
PROiP18847.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162772.
CleanExiHS_ATF3.
ExpressionAtlasiP18847. baseline and differential.
GenevisibleiP18847. HS.

Family and domain databases

InterProiIPR000837. AP-1.
IPR029812. ATF3.
IPR004827. bZIP.
[Graphical view]
PANTHERiPTHR23351. PTHR23351. 1 hit.
PTHR23351:SF23. PTHR23351:SF23. 1 hit.
PfamiPF00170. bZIP_1. 1 hit.
[Graphical view]
PRINTSiPR00042. LEUZIPPRFOS.
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEiPS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiATF3_HUMAN
AccessioniPrimary (citable) accession number: P18847
Secondary accession number(s): Q5VTZ2
, Q6ICQ9, Q7Z566, Q8WYM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: November 1, 1995
Last modified: November 2, 2016
This is version 172 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.