P18847 (ATF3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclic AMP-dependent transcription factor ATF-3 Short name=cAMP-dependent transcription factor ATF-3 Alternative name(s): Activating transcription factor 3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 181 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters. |
| Subunit structure | Binds DNA as a homodimer or a heterodimer. |
| Subcellular location | |
| Sequence similarities | Belongs to the bZIP family. ATF subfamily. Contains 1 bZIP (basic-leucine zipper) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-712767,EBI-712767 | ||
| FHL2 | Q14192 | 3 | EBI-712767,EBI-701903 | |
| RELA | Q04206 | 4 | EBI-712767,EBI-73886 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P18847-1) Also known as: ATF3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P18847-2) Also known as: ATF3-delta-Zip; The sequence of this isoform differs from the canonical sequence as follows: 116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: P18847-3) Also known as: ATF3-delta-Zip2a/TF3-delta-Zip2b; The sequence of this isoform differs from the canonical sequence as follows: 117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK | ||||||
| Note: Stress-induced isoform, counteracts the transcriptional repression of isoform 1. | ||||||
| Isoform 4 (identifier: P18847-4) Also known as: ATF3-delta-Zip2c; The sequence of this isoform differs from the canonical sequence as follows: 14-42: Missing. 117-181: ESEKLESVNA...QQIKEGTLQS → LPRPFWVQKTCIWAVDSCK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 181 | 181 | Cyclic AMP-dependent transcription factor ATF-3 | PRO_0000076581 | |||||
Regions | |||||||||
| Domain | 86 – 149 | 64 | bZIP | ||||||
| Region | 88 – 110 | 23 | Basic motif By similarity | ||||||
| Region | 114 – 142 | 29 | Leucine-zipper By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 14 – 42 | 29 | Missing in isoform 4. | VSP_043182 | |||||
| Alternative sequence | 116 – 181 | 66 | KESEK…GTLQS → LQY in isoform 2. | VSP_000592 | |||||
| Alternative sequence | 117 – 181 | 65 | ESEKL…GTLQS → LPRPFWVQKTCIWAVDSCK in isoform 3 and isoform 4. | VSP_043150 | |||||
| Natural variant | 38 | 1 | T → M. Ref.5 Corresponds to variant rs11571541 [ dbSNP | Ensembl ]. | VAR_048442 | |||||
Experimental info | |||||||||
| Sequence conflict | 132 | 1 | I → L no nucleotide entry Ref.11 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms." Chen B.P.C., Liang G., Whelan J., Hai T. J. Biol. Chem. 269:15819-15826(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "An alternatively spliced isoform of transcriptional repressor ATF3 and its induction by stress stimuli." Hashimoto Y., Zhang C., Kawauchi J., Imoto I., Adachi M.T., Inazawa J., Amagasa T., Hai T., Kitajima S. Nucleic Acids Res. 30:2398-2406(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING. |
| [3] | "Amino acid deprivation and endoplasmic reticulum stress induce expression of multiple activating transcription factor-3 mRNA species that, when overexpressed in HepG2 cells, modulate transcription by the human asparagine synthetase promoter." Pan Y., Chen H., Siu F., Kilberg M.S. J. Biol. Chem. 278:38402-38412(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | NIEHS SNPs program Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-38. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [7] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [8] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [11] | "Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers." Hai T., Liu F., Coukos W.J., Green M.R. Genes Dev. 3:2083-2090(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-181. |
| [12] | Erratum Hai T., Liu F., Coukos W.J., Green M.R. Genes Dev. 4:682-682(1990) |
| [13] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L19871 mRNA. Translation: AAA20506.1. AB066566 mRNA. Translation: BAB84092.1. AB078026 mRNA. Translation: BAC00495.1. AB078027 mRNA. Translation: BAC00496.1. AY313927 mRNA. Translation: AAP93896.1. BT006996 mRNA. Translation: AAP35642.1. AY426987 Genomic DNA. Translation: AAQ93358.1. AK312998 mRNA. Translation: BAG35834.1. CR450334 mRNA. Translation: CAG29330.1. AC092803 Genomic DNA. No translation available. AL590648 Genomic DNA. Translation: CAH72653.1. AL590648 Genomic DNA. Translation: CAH72654.1. AL590648 Genomic DNA. Translation: CAH72656.1. AL606913 Genomic DNA. No translation available. CH471100 Genomic DNA. Translation: EAW93385.1. CH471100 Genomic DNA. Translation: EAW93386.1. CH471100 Genomic DNA. Translation: EAW93387.1. CH471100 Genomic DNA. Translation: EAW93388.1. BC006322 mRNA. Translation: AAH06322.1. |
| IPI | IPI00002502. IPI00385188. IPI00413177. IPI01009242. |
| PIR | A54025. B54025. C34223. |
| RefSeq | NP_001025458.1. NM_001030287.3. NP_001035709.1. NM_001040619.2. NP_001193413.2. NM_001206484.2. NP_001193415.1. NM_001206486.2. NP_001193417.2. NM_001206488.2. NP_001665.1. NM_001674.3. |
| UniGene | Hs.460. |
3D structure databases | |
| ProteinModelPortal | P18847. |
| SMR | P18847. Positions 90-140. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-254N. DIP-344N. |
| IntAct | P18847. 10 interactions. |
| MINT | MINT-4649546. |
| STRING | 9606.ENSP00000344352. |
PTM databases | |
| PhosphoSite | P18847. |
Polymorphism databases | |
| DMDM | 1168543. |
Proteomic databases | |
| PaxDb | P18847. |
| PRIDE | P18847. |
Protocols and materials databases | |
| DNASU | 467. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000336937; ENSP00000336908; ENSG00000162772. ENST00000341491; ENSP00000344352; ENSG00000162772. ENST00000366983; ENSP00000355950; ENSG00000162772. ENST00000366987; ENSP00000355954; ENSG00000162772. ENST00000464547; ENSP00000432208; ENSG00000162772. |
| GeneID | 467. |
| KEGG | hsa:467. |
| UCSC | uc001hjf.3. human. |
Organism-specific databases | |
| CTD | 467. |
| GeneCards | GC01P212738. |
| HGNC | HGNC:785. ATF3. |
| HPA | HPA001562. |
| MIM | 603148. gene. |
| neXtProt | NX_P18847. |
| PharmGKB | PA25085. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG242494. |
| HOGENOM | HOG000034126. |
| HOVERGEN | HBG003381. |
| InParanoid | P18847. |
| KO | K09032. |
| OMA | LVYMLNL. |
| OrthoDB | EOG41NTN9. |
| PhylomeDB | P18847. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. |
| Reactome | REACT_116125. Disease. |
Gene expression databases | |
| ArrayExpress | P18847. |
| Bgee | P18847. |
| CleanEx | HS_ATF3. |
| Genevestigator | P18847. |
| GermOnline | ENSG00000162772. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004827. bZIP. IPR000837. Leuzip_Fos. [Graphical view] |
| Pfam | PF00170. bZIP_1. 1 hit. [Graphical view] |
| PRINTS | PR00042. LEUZIPPRFOS. |
| SMART | SM00338. BRLZ. 1 hit. [Graphical view] |
| PROSITE | PS50217. BZIP. 1 hit. PS00036. BZIP_BASIC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ATF3. human. |
| GenomeRNAi | 467. |
| NextBio | 1925. |
| SOURCE | Search... |
Entry information
| Entry name | ATF3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P18847 Secondary accession number(s): Q6ICQ9, Q7Z566, Q8WYM6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
