Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P18596

- AT2A3_RAT

UniProt

P18596 - AT2A3_RAT

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (22 Feb 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.1 Publication

    Catalytic activityi

    ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi309 – 3091Calcium 2By similarity
    Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
    Binding sitei515 – 5151ATPBy similarity
    Metal bindingi703 – 7031MagnesiumBy similarity
    Metal bindingi707 – 7071MagnesiumBy similarity
    Metal bindingi768 – 7681Calcium 1By similarity
    Metal bindingi771 – 7711Calcium 1By similarity
    Metal bindingi796 – 7961Calcium 2By similarity
    Metal bindingi799 – 7991Calcium 1By similarity
    Metal bindingi800 – 8001Calcium 1By similarity
    Metal bindingi800 – 8001Calcium 2By similarity
    Metal bindingi908 – 9081Calcium 1By similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. calcium-transporting ATPase activity Source: RGD
    3. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. calcium ion transmembrane transport Source: GOC
    2. calcium ion transport Source: RGD

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
    Short name:
    SERCA3
    Short name:
    SR Ca(2+)-ATPase 3
    Alternative name(s):
    Calcium pump 3
    Gene namesi
    Name:Atp2a3
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi2175. Atp2a3.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: RGD
    2. integral component of membrane Source: UniProtKB-KW
    3. nuclear membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10611061Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046205Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei662 – 6621PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiP18596.
    PRIDEiP18596.

    PTM databases

    PhosphoSiteiP18596.

    Expressioni

    Tissue specificityi

    Found in most tissues. Most abundant in large and small intestine, spleen and lung. Also detected in PC12 cells.2 Publications

    Inductioni

    Isoform SERCA3BC is down-regulated in all tissues except pancreas in a rat hypertension model.1 Publication

    Gene expression databases

    GenevestigatoriP18596.

    Interactioni

    Protein-protein interaction databases

    STRINGi10116.ENSRNOP00000060212.

    Structurei

    3D structure databases

    ProteinModelPortaliP18596.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4848CytoplasmicBy similarityAdd
    BLAST
    Topological domaini70 – 8920LumenalBy similarityAdd
    BLAST
    Topological domaini111 – 253143CytoplasmicBy similarityAdd
    BLAST
    Topological domaini274 – 29522LumenalBy similarityAdd
    BLAST
    Topological domaini314 – 757444CytoplasmicBy similarityAdd
    BLAST
    Topological domaini778 – 78710LumenalBy similarity
    Topological domaini809 – 82820CytoplasmicBy similarityAdd
    BLAST
    Topological domaini852 – 89746LumenalBy similarityAdd
    BLAST
    Topological domaini918 – 93013CytoplasmicBy similarityAdd
    BLAST
    Topological domaini950 – 96415LumenalBy similarityAdd
    BLAST
    Topological domaini986 – 106176CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei49 – 6921Helical; Name=1By similarityAdd
    BLAST
    Transmembranei90 – 11021Helical; Name=2By similarityAdd
    BLAST
    Transmembranei254 – 27320Helical; Name=3By similarityAdd
    BLAST
    Transmembranei296 – 31318Helical; Name=4By similarityAdd
    BLAST
    Transmembranei758 – 77720Helical; Name=5By similarityAdd
    BLAST
    Transmembranei788 – 80821Helical; Name=6By similarityAdd
    BLAST
    Transmembranei829 – 85123Helical; Name=7By similarityAdd
    BLAST
    Transmembranei898 – 91720Helical; Name=8By similarityAdd
    BLAST
    Transmembranei931 – 94919Helical; Name=9By similarityAdd
    BLAST
    Transmembranei965 – 98521Helical; Name=10By similarityAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    HOGENOMiHOG000265621.
    HOVERGENiHBG105648.
    InParanoidiP18596.
    KOiK05853.

    Family and domain databases

    Gene3Di1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PfamiPF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    SMARTiSM00831. Cation_ATPase_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 2 hits.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform SERCA3BC (identifier: P18596-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEAHLLSAA DVLRRFSVTA EGGLTLEQVT DARERYGPNE LPTEEGKSLW     50
    ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA 100
    NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI 150
    VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV 200
    NQDKKNMLFS GTNIASGKAL GVAVATGLHT ELGKIRSQMA AVEPERTPLQ 250
    RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV 300
    ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS 350
    DKTGTLTTNQ MSVCRMFVVA EAEAGACRLH EFTISGTTYT PEGEVRQGEQ 400
    LVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE 450
    KMNVFDTDLK GLSRVERAGA CNSVIKQLMQ KEFTLEFSRD RKSMSVYCTP 500
    TRADPKAQGS KMFVKGAPES VIERCSSVRV GSRTVPLSAT SREHILAKIR 550
    DWGSGSHTLR CLALATRDTP PRKEDMQLDD CSQFVQYETG LTFVGCVGML 600
    DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG 650
    KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM 700
    TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG 750
    RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD 800
    GLPATALGFN PPDLDIMEKL PRNPREALIS GWLFFRYLAI GVYVGLATVA 850
    AATWWFLYDA EGPQVTFHQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA 900
    LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV 950
    PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRH HVDGVLETFM 1000
    QAWCKQPLPG PHTTRGWLPG CHFNGWEQTE EFVFIQERWT VSGLGPEKKA 1050
    RERLGLVSAA S 1061
    Length:1,061
    Mass (Da):116,284
    Last modified:February 22, 2012 - v2
    Checksum:iB907C7FA73750D14
    GO
    Isoform SERCA3A (identifier: P18596-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         994-1061: GVLETFMQAWCKQPLPGPHTTRGWLPGCHFNGWEQTEEFVFIQERWTVSGLGPEKKARERLGLVSAAS → EKKDLK

    Show »
    Length:999
    Mass (Da):109,359
    Checksum:i8A6AEE29021AA379
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei994 – 106168GVLET…VSAAS → EKKDLK in isoform SERCA3A. 1 PublicationVSP_042297Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M30581 mRNA. Translation: AAA42131.1.
    AF458230 mRNA. Translation: AAL78969.1.
    PIRiA34307.
    RefSeqiNP_037046.1. NM_012914.1. [P18596-2]
    UniGeneiRn.9920.

    Genome annotation databases

    GeneIDi25391.
    KEGGirno:25391.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M30581 mRNA. Translation: AAA42131.1 .
    AF458230 mRNA. Translation: AAL78969.1 .
    PIRi A34307.
    RefSeqi NP_037046.1. NM_012914.1. [P18596-2 ]
    UniGenei Rn.9920.

    3D structure databases

    ProteinModelPortali P18596.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10116.ENSRNOP00000060212.

    PTM databases

    PhosphoSitei P18596.

    Proteomic databases

    PaxDbi P18596.
    PRIDEi P18596.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 25391.
    KEGGi rno:25391.

    Organism-specific databases

    CTDi 489.
    RGDi 2175. Atp2a3.

    Phylogenomic databases

    eggNOGi COG0474.
    HOGENOMi HOG000265621.
    HOVERGENi HBG105648.
    InParanoidi P18596.
    KOi K05853.

    Miscellaneous databases

    NextBioi 606461.
    PROi P18596.

    Gene expression databases

    Genevestigatori P18596.

    Family and domain databases

    Gene3Di 1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    Pfami PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    SMARTi SM00831. Cation_ATPase_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 2 hits.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning, functional expression, and mRNA tissue distribution of a third organellar Ca2+ pump."
      Burk S.E., Lytton J., McLennan D.H., Shull G.E.
      J. Biol. Chem. 264:18561-18568(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SERCA3A), CHARACTERIZATION, TISSUE SPECIFICITY.
      Tissue: Kidney.
    2. "Platelet Ca(2+)ATPases: a plural, species-specific, and multiple hypertension-regulated expression system."
      Martin V., Bredoux R., Corvazier E., Papp B., Enouf J.
      Hypertension 35:91-102(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 869-1061 (ISOFORM SERCA3BC), FUNCTION, TISSUE SPECIFICITY, INDUCTION.
      Strain: Wistar Kyoto.

    Entry informationi

    Entry nameiAT2A3_RAT
    AccessioniPrimary (citable) accession number: P18596
    Secondary accession number(s): Q8R5I9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1990
    Last sequence update: February 22, 2012
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3