Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.1 Publication
This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.By similarity

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Inhibited by sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity). Enhanced by DWORF; DWORF increases activity by displacing sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi305Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi307Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi309Calcium 2By similarity1
Active sitei3514-aspartylphosphate intermediateBy similarity1
Binding sitei515ATPBy similarity1
Metal bindingi703MagnesiumBy similarity1
Metal bindingi707MagnesiumBy similarity1
Metal bindingi768Calcium 1By similarity1
Metal bindingi771Calcium 1By similarity1
Metal bindingi796Calcium 2By similarity1
Metal bindingi799Calcium 1By similarity1
Metal bindingi800Calcium 1By similarity1
Metal bindingi800Calcium 2By similarity1
Metal bindingi908Calcium 1By similarity1

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • calcium-transporting ATPase activity Source: RGD
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • calcium ion transport Source: RGD
  • cellular calcium ion homeostasis Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:Atp2a3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi2175. Atp2a3.

Subcellular locationi

  • Endoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity
  • Sarcoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 48CytoplasmicBy similarityAdd BLAST48
Transmembranei49 – 69Helical; Name=1By similarityAdd BLAST21
Topological domaini70 – 89LumenalBy similarityAdd BLAST20
Transmembranei90 – 110Helical; Name=2By similarityAdd BLAST21
Topological domaini111 – 253CytoplasmicBy similarityAdd BLAST143
Transmembranei254 – 273Helical; Name=3By similarityAdd BLAST20
Topological domaini274 – 295LumenalBy similarityAdd BLAST22
Transmembranei296 – 313Helical; Name=4By similarityAdd BLAST18
Topological domaini314 – 757CytoplasmicBy similarityAdd BLAST444
Transmembranei758 – 777Helical; Name=5By similarityAdd BLAST20
Topological domaini778 – 787LumenalBy similarity10
Transmembranei788 – 808Helical; Name=6By similarityAdd BLAST21
Topological domaini809 – 828CytoplasmicBy similarityAdd BLAST20
Transmembranei829 – 851Helical; Name=7By similarityAdd BLAST23
Topological domaini852 – 897LumenalBy similarityAdd BLAST46
Transmembranei898 – 917Helical; Name=8By similarityAdd BLAST20
Topological domaini918 – 930CytoplasmicBy similarityAdd BLAST13
Transmembranei931 – 949Helical; Name=9By similarityAdd BLAST19
Topological domaini950 – 964LumenalBy similarityAdd BLAST15
Transmembranei965 – 985Helical; Name=10By similarityAdd BLAST21
Topological domaini986 – 1061CytoplasmicBy similarityAdd BLAST76

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000462051 – 1061Sarcoplasmic/endoplasmic reticulum calcium ATPase 3Add BLAST1061

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei17PhosphoserineBy similarity1
Modified residuei19PhosphothreonineBy similarity1
Modified residuei415PhosphothreonineBy similarity1
Modified residuei662PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP18596.
PRIDEiP18596.

PTM databases

iPTMnetiP18596.
PhosphoSitePlusiP18596.

Expressioni

Tissue specificityi

Found in most tissues. Most abundant in large and small intestine, spleen and lung. Also detected in PC12 cells.2 Publications

Inductioni

Isoform SERCA3BC is down-regulated in all tissues except pancreas in a rat hypertension model.1 Publication

Interactioni

Subunit structurei

Interacts with sarcolipin (SLN) (By similarity). Interacts with phospholamban (PLN) (By similarity). Interacts with myoregulin (MRLN). Interacts with DWORF (By similarity).By similarity

Protein-protein interaction databases

BioGridi247429. 1 interactor.
STRINGi10116.ENSRNOP00000060212.

Structurei

3D structure databases

ProteinModelPortaliP18596.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni370 – 400Interaction with phospholamban 1By similarityAdd BLAST31
Regioni788 – 808Interaction with phospholamban 2By similarityAdd BLAST21

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP18596.
KOiK05853.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF295. PTHR24093:SF295. 2 hits.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform SERCA3BC (identifier: P18596-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEAHLLSAA DVLRRFSVTA EGGLTLEQVT DARERYGPNE LPTEEGKSLW
60 70 80 90 100
ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIASGKAL GVAVATGLHT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EAEAGACRLH EFTISGTTYT PEGEVRQGEQ
410 420 430 440 450
LVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLK GLSRVERAGA CNSVIKQLMQ KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRADPKAQGS KMFVKGAPES VIERCSSVRV GSRTVPLSAT SREHILAKIR
560 570 580 590 600
DWGSGSHTLR CLALATRDTP PRKEDMQLDD CSQFVQYETG LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKL PRNPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFLYDA EGPQVTFHQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRH HVDGVLETFM
1010 1020 1030 1040 1050
QAWCKQPLPG PHTTRGWLPG CHFNGWEQTE EFVFIQERWT VSGLGPEKKA
1060
RERLGLVSAA S
Length:1,061
Mass (Da):116,284
Last modified:February 22, 2012 - v2
Checksum:iB907C7FA73750D14
GO
Isoform SERCA3A (identifier: P18596-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1061: GVLETFMQAWCKQPLPGPHTTRGWLPGCHFNGWEQTEEFVFIQERWTVSGLGPEKKARERLGLVSAAS → EKKDLK

Show »
Length:999
Mass (Da):109,359
Checksum:i8A6AEE29021AA379
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042297994 – 1061GVLET…VSAAS → EKKDLK in isoform SERCA3A. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M30581 mRNA. Translation: AAA42131.1.
AF458230 mRNA. Translation: AAL78969.1.
PIRiA34307.
RefSeqiNP_037046.1. NM_012914.1. [P18596-2]
UniGeneiRn.9920.

Genome annotation databases

GeneIDi25391.
KEGGirno:25391.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M30581 mRNA. Translation: AAA42131.1.
AF458230 mRNA. Translation: AAL78969.1.
PIRiA34307.
RefSeqiNP_037046.1. NM_012914.1. [P18596-2]
UniGeneiRn.9920.

3D structure databases

ProteinModelPortaliP18596.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi247429. 1 interactor.
STRINGi10116.ENSRNOP00000060212.

PTM databases

iPTMnetiP18596.
PhosphoSitePlusiP18596.

Proteomic databases

PaxDbiP18596.
PRIDEiP18596.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi25391.
KEGGirno:25391.

Organism-specific databases

CTDi489.
RGDi2175. Atp2a3.

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP18596.
KOiK05853.

Miscellaneous databases

PROiP18596.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF295. PTHR24093:SF295. 2 hits.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAT2A3_RAT
AccessioniPrimary (citable) accession number: P18596
Secondary accession number(s): Q8R5I9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: February 22, 2012
Last modified: November 2, 2016
This is version 147 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.