P18596 (AT2A3_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name=SERCA3 Short name=SR Ca(2+)-ATPase 3 EC=3.6.3.8 Alternative name(s): Calcium pump 3 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1061 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Ref.2 |
| Catalytic activity | ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2). |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Nucleus membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Found in most tissues. Most abundant in large and small intestine, spleen and lung. Also detected in PC12 cells. Ref.1 Ref.2 |
| Induction | Isoform SERCA3BC is down-regulated in all tissues except pancreas in a rat hypertension model. Ref.2 |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Cellular component | Endoplasmic reticulum Membrane Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | ATP-binding Calcium Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | endoplasmic reticulum membrane Inferred from direct assay PubMed 11956212. Source: RGD integral to membraneInferred from electronic annotation. Source: UniProtKB-KW nuclear membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW calcium-transporting ATPase activityInferred from direct assay PubMed 11956212. Source: RGD metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA3BC (identifier: P18596-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA3A (identifier: P18596-2) The sequence of this isoform differs from the canonical sequence as follows: 994-1061: GVLETFMQAWCKQPLPGPHTTRGWLPGCHFNGWEQTEEFVFIQERWTVSGLGPEKKARERLGLVSAAS → EKKDLK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1061 | 1061 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | PRO_0000046205 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 757 | 444 | Cytoplasmic By similarity | ||||||
| Transmembrane | 758 – 777 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 778 – 787 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 788 – 808 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 809 – 828 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 829 – 851 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 852 – 897 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 898 – 917 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 918 – 930 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 931 – 949 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 950 – 964 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 965 – 985 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 986 – 1061 | 76 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 703 | 1 | Magnesium By similarity | ||||||
| Metal binding | 707 | 1 | Magnesium By similarity | ||||||
| Metal binding | 768 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 771 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 796 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 908 | 1 | Calcium 1 By similarity | ||||||
| Binding site | 515 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
| Modified residue | 662 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1061 | 68 | GVLET…VSAAS → EKKDLK in isoform SERCA3A. | VSP_042297 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "cDNA cloning, functional expression, and mRNA tissue distribution of a third organellar Ca2+ pump." Burk S.E., Lytton J., McLennan D.H., Shull G.E. J. Biol. Chem. 264:18561-18568(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SERCA3A), CHARACTERIZATION, TISSUE SPECIFICITY. Tissue: Kidney. |
| [2] | "Platelet Ca(2+)ATPases: a plural, species-specific, and multiple hypertension-regulated expression system." Martin V., Bredoux R., Corvazier E., Papp B., Enouf J. Hypertension 35:91-102(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 869-1061 (ISOFORM SERCA3BC), FUNCTION, TISSUE SPECIFICITY, INDUCTION. Strain: Wistar Kyoto. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M30581 mRNA. Translation: AAA42131.1. AF458230 mRNA. Translation: AAL78969.1. |
| IPI | IPI00392927. IPI00950187. |
| PIR | A34307. |
| RefSeq | NP_037046.1. NM_012914.1. |
| UniGene | Rn.9920. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10116.ENSRNOP00000060212. |
PTM databases | |
| PhosphoSite | P18596. |
Proteomic databases | |
| PaxDb | P18596. |
| PRIDE | P18596. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 25391. |
| KEGG | rno:25391. |
Organism-specific databases | |
| CTD | 489. |
| RGD | 2175. Atp2a3. |
Phylogenomic databases | |
| eggNOG | COG0474. |
| HOGENOM | HOG000265621. |
| HOVERGEN | HBG105648. |
| InParanoid | P18596. |
| KO | K05853. |
Gene expression databases | |
| ArrayExpress | P18596. |
| Genevestigator | P18596. |
| GermOnline | ENSRNOG00000017912. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 1.20.1110.10. 2 hits. 2.70.150.10. 2 hits. 3.40.1110.10. 1 hit. |
| InterPro | IPR005782. ATPase_P-typ_Ca-transp_IIA. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023299. ATPase_P-typ_cyto_domN. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR008250. ATPase_P-typ_transduc_dom_A. IPR001757. Cation_transp_P_typ_ATPase. IPR023214. HAD-like_dom. [Graphical view] |
| PANTHER | PTHR24093. PTHR24093. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 2 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 606461. |
Entry information
| Entry name | AT2A3_RAT | ||||||||
| Accession | Primary (citable) accession number: P18596 Secondary accession number(s): Q8R5I9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
