Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P18596

- AT2A3_RAT

UniProt

P18596 - AT2A3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.1 Publication

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi309 – 3091Calcium 2By similarity
Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
Binding sitei515 – 5151ATPBy similarity
Metal bindingi703 – 7031MagnesiumBy similarity
Metal bindingi707 – 7071MagnesiumBy similarity
Metal bindingi768 – 7681Calcium 1By similarity
Metal bindingi771 – 7711Calcium 1By similarity
Metal bindingi796 – 7961Calcium 2By similarity
Metal bindingi799 – 7991Calcium 1By similarity
Metal bindingi800 – 8001Calcium 1By similarity
Metal bindingi800 – 8001Calcium 2By similarity
Metal bindingi908 – 9081Calcium 1By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. calcium-transporting ATPase activity Source: RGD
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. calcium ion transmembrane transport Source: GOC
  2. calcium ion transport Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:Atp2a3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi2175. Atp2a3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848CytoplasmicBy similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1By similarityAdd
BLAST
Topological domaini70 – 8920LumenalBy similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2By similarityAdd
BLAST
Topological domaini111 – 253143CytoplasmicBy similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3By similarityAdd
BLAST
Topological domaini274 – 29522LumenalBy similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4By similarityAdd
BLAST
Topological domaini314 – 757444CytoplasmicBy similarityAdd
BLAST
Transmembranei758 – 77720Helical; Name=5By similarityAdd
BLAST
Topological domaini778 – 78710LumenalBy similarity
Transmembranei788 – 80821Helical; Name=6By similarityAdd
BLAST
Topological domaini809 – 82820CytoplasmicBy similarityAdd
BLAST
Transmembranei829 – 85123Helical; Name=7By similarityAdd
BLAST
Topological domaini852 – 89746LumenalBy similarityAdd
BLAST
Transmembranei898 – 91720Helical; Name=8By similarityAdd
BLAST
Topological domaini918 – 93013CytoplasmicBy similarityAdd
BLAST
Transmembranei931 – 94919Helical; Name=9By similarityAdd
BLAST
Topological domaini950 – 96415LumenalBy similarityAdd
BLAST
Transmembranei965 – 98521Helical; Name=10By similarityAdd
BLAST
Topological domaini986 – 106176CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: RGD
  2. integral component of membrane Source: UniProtKB-KW
  3. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10611061Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046205Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei662 – 6621PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP18596.
PRIDEiP18596.

PTM databases

PhosphoSiteiP18596.

Expressioni

Tissue specificityi

Found in most tissues. Most abundant in large and small intestine, spleen and lung. Also detected in PC12 cells.2 Publications

Inductioni

Isoform SERCA3BC is down-regulated in all tissues except pancreas in a rat hypertension model.1 Publication

Gene expression databases

GenevestigatoriP18596.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000060212.

Structurei

3D structure databases

ProteinModelPortaliP18596.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiP18596.
KOiK05853.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform SERCA3BC (identifier: P18596-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEAHLLSAA DVLRRFSVTA EGGLTLEQVT DARERYGPNE LPTEEGKSLW
60 70 80 90 100
ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIASGKAL GVAVATGLHT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EAEAGACRLH EFTISGTTYT PEGEVRQGEQ
410 420 430 440 450
LVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLK GLSRVERAGA CNSVIKQLMQ KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRADPKAQGS KMFVKGAPES VIERCSSVRV GSRTVPLSAT SREHILAKIR
560 570 580 590 600
DWGSGSHTLR CLALATRDTP PRKEDMQLDD CSQFVQYETG LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKL PRNPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFLYDA EGPQVTFHQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRH HVDGVLETFM
1010 1020 1030 1040 1050
QAWCKQPLPG PHTTRGWLPG CHFNGWEQTE EFVFIQERWT VSGLGPEKKA
1060
RERLGLVSAA S
Length:1,061
Mass (Da):116,284
Last modified:February 22, 2012 - v2
Checksum:iB907C7FA73750D14
GO
Isoform SERCA3A (identifier: P18596-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1061: GVLETFMQAWCKQPLPGPHTTRGWLPGCHFNGWEQTEEFVFIQERWTVSGLGPEKKARERLGLVSAAS → EKKDLK

Show »
Length:999
Mass (Da):109,359
Checksum:i8A6AEE29021AA379
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 106168GVLET…VSAAS → EKKDLK in isoform SERCA3A. 1 PublicationVSP_042297Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M30581 mRNA. Translation: AAA42131.1.
AF458230 mRNA. Translation: AAL78969.1.
PIRiA34307.
RefSeqiNP_037046.1. NM_012914.1. [P18596-2]
UniGeneiRn.9920.

Genome annotation databases

GeneIDi25391.
KEGGirno:25391.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M30581 mRNA. Translation: AAA42131.1 .
AF458230 mRNA. Translation: AAL78969.1 .
PIRi A34307.
RefSeqi NP_037046.1. NM_012914.1. [P18596-2 ]
UniGenei Rn.9920.

3D structure databases

ProteinModelPortali P18596.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10116.ENSRNOP00000060212.

PTM databases

PhosphoSitei P18596.

Proteomic databases

PaxDbi P18596.
PRIDEi P18596.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25391.
KEGGi rno:25391.

Organism-specific databases

CTDi 489.
RGDi 2175. Atp2a3.

Phylogenomic databases

eggNOGi COG0474.
HOGENOMi HOG000265621.
HOVERGENi HBG105648.
InParanoidi P18596.
KOi K05853.

Miscellaneous databases

NextBioi 606461.
PROi P18596.

Gene expression databases

Genevestigatori P18596.

Family and domain databases

Gene3Di 1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 2 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "cDNA cloning, functional expression, and mRNA tissue distribution of a third organellar Ca2+ pump."
    Burk S.E., Lytton J., McLennan D.H., Shull G.E.
    J. Biol. Chem. 264:18561-18568(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SERCA3A), CHARACTERIZATION, TISSUE SPECIFICITY.
    Tissue: Kidney.
  2. "Platelet Ca(2+)ATPases: a plural, species-specific, and multiple hypertension-regulated expression system."
    Martin V., Bredoux R., Corvazier E., Papp B., Enouf J.
    Hypertension 35:91-102(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 869-1061 (ISOFORM SERCA3BC), FUNCTION, TISSUE SPECIFICITY, INDUCTION.
    Strain: Wistar Kyoto.

Entry informationi

Entry nameiAT2A3_RAT
AccessioniPrimary (citable) accession number: P18596
Secondary accession number(s): Q8R5I9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: February 22, 2012
Last modified: October 29, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3