Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P18583

- SON_HUMAN

UniProt

P18583 - SON_HUMAN

Protein

Protein SON

Gene

SON

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 4 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    RNA-binding protein that acts as a mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites. Specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG. Probably acts by facilitating the interaction between Serine/arginine-rich proteins such as SRSF2 and the RNA polymerase II. Also binds to DNA; binds to the consensus DNA sequence: 5'-GA[GT]AN[CG][AG]CC-3'. May indirectly repress hepatitis B virus (HBV) core promoter activity and transcription of HBV genes and production of HBV virions.2 Publications

    GO - Molecular functioni

    1. DNA binding Source: ProtInc
    2. nucleic acid binding Source: UniProtKB
    3. poly(A) RNA binding Source: UniProtKB
    4. protein binding Source: UniProtKB
    5. RNA binding Source: UniProtKB

    GO - Biological processi

    1. cytokinesis Source: UniProtKB
    2. microtubule cytoskeleton organization Source: UniProtKB
    3. mRNA processing Source: UniProtKB
    4. negative regulation of apoptotic process Source: UniProtKB
    5. regulation of cell cycle Source: UniProtKB
    6. regulation of RNA splicing Source: UniProtKB
    7. RNA splicing Source: UniProtKB-KW

    Keywords - Biological processi

    Cell cycle, mRNA processing, mRNA splicing

    Keywords - Ligandi

    DNA-binding, RNA-binding

    Protein family/group databases

    TCDBi3.A.18.1.1. the nuclear mrna exporter (mrna-e) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein SON
    Alternative name(s):
    Bax antagonist selected in saccharomyces 1
    Short name:
    BASS1
    Negative regulatory element-binding protein
    Short name:
    NRE-binding protein
    Protein DBP-5
    SON3
    Gene namesi
    Name:SON
    Synonyms:C21orf50, DBP5, KIAA1019, NREBP
    ORF Names:HSPC310, HSPC312
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 21

    Organism-specific databases

    HGNCiHGNC:11183. SON.

    Subcellular locationi

    Nucleus speckle 2 Publications
    Note: Colocalizes with the pre-mRNA splicing factor SRSF2.

    GO - Cellular componenti

    1. nuclear speck Source: UniProtKB
    2. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36020.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed2 Publications
    Chaini2 – 24262425Protein SONPRO_0000072037Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine2 Publications
    Modified residuei16 – 161N6-acetyllysine1 Publication
    Modified residuei94 – 941Phosphoserine1 Publication
    Modified residuei142 – 1421Phosphoserine1 Publication
    Modified residuei152 – 1521Phosphoserine4 Publications
    Modified residuei154 – 1541Phosphoserine3 Publications
    Modified residuei160 – 1601Phosphoserine1 Publication
    Modified residuei283 – 2831Phosphoserine3 Publications
    Modified residuei288 – 2881N6-acetyllysine1 Publication
    Modified residuei1556 – 15561Phosphoserine3 Publications
    Modified residuei1697 – 16971Phosphoserine4 Publications
    Modified residuei1769 – 17691Phosphoserine2 Publications
    Modified residuei1783 – 17831Phosphoserine1 Publication
    Modified residuei1948 – 19481Phosphoserine1 Publication
    Modified residuei1950 – 19501Phosphoserine1 Publication
    Modified residuei2009 – 20091Phosphoserine1 Publication
    Modified residuei2011 – 20111Phosphoserine2 Publications
    Modified residuei2013 – 20131Phosphoserine2 Publications
    Modified residuei2055 – 20551N6-acetyllysine1 Publication
    Modified residuei2163 – 21631Phosphothreonine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiP18583.
    PaxDbiP18583.
    PRIDEiP18583.

    PTM databases

    PhosphoSiteiP18583.

    Expressioni

    Tissue specificityi

    Widely expressed, with the higher expression seen in leukocyte and heart.

    Gene expression databases

    ArrayExpressiP18583.
    BgeeiP18583.
    GenevestigatoriP18583.

    Organism-specific databases

    HPAiHPA023535.
    HPA031755.
    HPA031756.

    Interactioni

    Subunit structurei

    Interacts with SRSF2. Associates with the spliceosome. Interacts with the AML1-MTG8 (AML1-ETO) fusion protein, possibly leading to trigger signals inhibiting leukemogenesis.3 Publications

    Protein-protein interaction databases

    BioGridi112534. 64 interactions.
    DIPiDIP-42289N.
    IntActiP18583. 16 interactions.
    MINTiMINT-1200716.

    Structurei

    3D structure databases

    ProteinModelPortaliP18583.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati1006 – 101161-1
    Repeati1014 – 101961-2
    Repeati1021 – 102661-3
    Repeati1030 – 103561-4
    Repeati1038 – 104361-5
    Repeati1046 – 105161-6
    Repeati1055 – 106061-7
    Repeati1063 – 106861-8
    Repeati1071 – 107661-9
    Repeati1080 – 108561-10
    Repeati1089 – 109461-11
    Repeati1100 – 110561-12
    Repeati1111 – 111661-13
    Repeati1121 – 112661-14
    Repeati1925 – 193172-1
    Repeati1934 – 1952193-1Add
    BLAST
    Repeati1953 – 195972-2
    Repeati1960 – 196672-3
    Repeati1967 – 197372-4
    Repeati1974 – 198072-5
    Repeati1981 – 198772-6
    Repeati1988 – 199472-7
    Repeati1995 – 2013193-2Add
    BLAST
    Domaini2305 – 235147G-patchPROSITE-ProRule annotationAdd
    BLAST
    Domaini2371 – 242656DRBMPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni726 – 89517017 X 10 AA tandem repeats of L-A-[ST]-[NSG]-[TS]-MDSQMAdd
    BLAST
    Regioni912 – 9887711 X 7 AA tandem repeats of [DR]-P-Y-R-[LI][AG][QHP]Add
    BLAST
    Regioni1006 – 112612114 X 6 AA repeats of [ED]-R-S-M-M-SAdd
    BLAST
    Regioni1147 – 1179333 X 11 AA tandem repats of P-P-L-P-P-E-E-P-P-[TME]-[MTG]Add
    BLAST
    Regioni1359 – 1390324 X 8 AA tandem repeats of V-L-E-SS-[AVT]-VTAdd
    BLAST
    Regioni1925 – 1994707 X 7 AA repeats of P-S-R-R-S-R-[TS]Add
    BLAST
    Regioni1934 – 2013802 X 19 AA repeats of P-S-R-R-R-R-S-R-S-V-V-R-R-R-S-F-S-I-SAdd
    BLAST
    Regioni2013 – 2039273 X tandem repeats of [ST]-P-[VLI]-R-[RL]-[RK]-[RF]-S-RAdd
    BLAST

    Domaini

    Sequence similaritiesi

    Contains 1 DRBM (double-stranded RNA-binding) domain.PROSITE-ProRule annotation
    Contains 1 G-patch domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG254690.
    HOVERGENiHBG023160.
    InParanoidiP18583.
    OMAiEIPTKKS.
    OrthoDBiEOG73NG3J.
    PhylomeDBiP18583.
    TreeFamiTF330344.

    Family and domain databases

    Gene3Di3.30.160.20. 1 hit.
    InterProiIPR014720. dsRNA-bd_dom.
    IPR000467. G_patch_dom.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF01585. G-patch. 1 hit.
    [Graphical view]
    SMARTiSM00443. G_patch. 1 hit.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS50137. DS_RBD. 1 hit.
    PS50174. G_PATCH. 1 hit.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform F (identifier: P18583-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATNIEQIFR SFVVSKFREI QQELSSGRNE GQLNGETNTP IEGNQAGDAA     50
    ASARSLPNEE IVQKIEEVLS GVLDTELRYK PDLKEGSRKS RCVSVQTDPT 100
    DEIPTKKSKK HKKHKNKKKK KKKEKEKKYK RQPEESESKT KSHDDGNIDL 150
    ESDSFLKFDS EPSAVALELP TRAFGPSETN ESPAVVLEPP VVSMEVSEPH 200
    ILETLKPATK TAELSVVSTS VISEQSEQSV AVMPEPSMTK ILDSFAAAPV 250
    PTTTLVLKSS EPVVTMSVEY QMKSVLKSVE STSPEPSKIM LVEPPVAKVL 300
    EPSETLVVSS ETPTEVYPEP STSTTMDFPE SSAIEALRLP EQPVDVPSEI 350
    ADSSMTRPQE LPELPKTTAL ELQESSVASA MELPGPPATS MPELQGPPVT 400
    PVLELPGPSA TPVPELPGPL STPVPELPGP PATAVPELPG PSVTPVPQLS 450
    QELPGLPAPS MGLEPPQEVP EPPVMAQELP GLPLVTAAVE LPEQPAVTVA 500
    MELTEQPVTT TELEQPVGMT TVEHPGHPEV TTATGLLGQP EATMVLELPG 550
    QPVATTALEL PGQPSVTGVP ELPGLPSATR ALELSGQPVA TGALELPGPL 600
    MAAGALEFSG QSGAAGALEL LGQPLATGVL ELPGQPGAPE LPGQPVATVA 650
    LEISVQSVVT TSELSTMTVS QSLEVPSTTA LESYNTVAQE LPTTLVGETS 700
    VTVGVDPLMA PESHILASNT METHILASNT MDSQMLASNT MDSQMLASNT 750
    MDSQMLASST MDSQMLATSS MDSQMLATSS MDSQMLATST MDSQMLATSS 800
    MDSQMLATSS MDSQMLATSS MDSQMLATSS MDSQMLATST MDSQMLATST 850
    MDSQMLATSS MDSQMLASGT MDSQMLASGT MDAQMLASGT MDAQMLASST 900
    QDSAMLGSKS PDPYRLAQDP YRLAQDPYRL GHDPYRLGHD AYRLGQDPYR 950
    LGHDPYRLTP DPYRMSPRPY RIAPRSYRIA PRPYRLAPRP LMLASRRSMM 1000
    MSYAAERSMM SSYERSMMSY ERSMMSPMAE RSMMSAYERS MMSAYERSMM 1050
    SPMAERSMMS AYERSMMSAY ERSMMSPMAD RSMMSMGADR SMMSSYSAAD 1100
    RSMMSSYSAA DRSMMSSYTA DRSMMSMAAD SYTDSYTDTY TEAYMVPPLP 1150
    PEEPPTMPPL PPEEPPMTPP LPPEEPPEGP ALPTEQSALT AENTWPTEVP 1200
    SSPSEESVSQ PEPPVSQSEI SEPSAVPTDY SVSASDPSVL VSEAAVTVPE 1250
    PPPEPESSIT LTPVESAVVA EEHEVVPERP VTCMVSETPA MSAEPTVLAS 1300
    EPPVMSETAE TFDSMRASGH VASEVSTSLL VPAVTTPVLA ESILEPPAMA 1350
    APESSAMAVL ESSAVTVLES STVTVLESST VTVLEPSVVT VPEPPVVAEP 1400
    DYVTIPVPVV SALEPSVPVL EPAVSVLQPS MIVSEPSVSV QESTVTVSEP 1450
    AVTVSEQTQV IPTEVAIEST PMILESSIMS SHVMKGINLS SGDQNLAPEI 1500
    GMQEIALHSG EEPHAEEHLK GDFYESEHGI NIDLNINNHL IAKEMEHNTV 1550
    CAAGTSPVGE IGEEKILPTS ETKQRTVLDT YPGVSEADAG ETLSSTGPFA 1600
    LEPDATGTSK GIEFTTASTL SLVNKYDVDL SLTTQDTEHD MVISTSPSGG 1650
    SEADIEGPLP AKDIHLDLPS NNNLVSKDTE EPLPVKESDQ TLAALLSPKE 1700
    SSGGEKEVPP PPKETLPDSG FSANIEDINE ADLVRPLLPK DMERLTSLRA 1750
    GIEGPLLASD VGRDRSAASP VVSSMPERAS ESSSEEKDDY EIFVKVKDTH 1800
    EKSKKNKNRD KGEKEKKRDS SLRSRSKRSK SSEHKSRKRT SESRSRARKR 1850
    SSKSKSHRSQ TRSRSRSRRR RRSSRSRSKS RGRRSVSKEK RKRSPKHRSK 1900
    SRERKRKRSS SRDNRKTVRA RSRTPSRRSR SHTPSRRRRS RSVGRRRSFS 1950
    ISPSRRSRTP SRRSRTPSRR SRTPSRRSRT PSRRSRTPSR RSRTPSRRRR 2000
    SRSVVRRRSF SISPVRLRRS RTPLRRRFSR SPIRRKRSRS SERGRSPKRL 2050
    TDLDKAQLLE IAKANAAAMC AKAGVPLPPN LKPAPPPTIE EKVAKKSGGA 2100
    TIEELTEKCK QIAQSKEDDD VIVNKPHVSD EEEEEPPFYH HPFKLSEPKP 2150
    IFFNLNIAAA KPTPPKSQVT LTKEFPVSSG SQHRKKEADS VYGEWVPVEK 2200
    NGEENKDDDN VFSSNLPSEP VDISTAMSER ALAQKRLSEN AFDLEAMSML 2250
    NRAQERIDAW AQLNSIPGQF TGSTGVQVLT QEQLANTGAQ AWIKKDQFLR 2300
    AAPVTGGMGA VLMRKMGWRE GEGLGKNKEG NKEPILVDFK TDRKGLVAVG 2350
    ERAQKRSGNF SAAMKDLSGK HPVSALMEIC NKRRWQPPEF LLVHDSGPDH 2400
    RKHFLFRVLR NGALTRPNCM FFLNRY 2426
    Length:2,426
    Mass (Da):263,830
    Last modified:May 18, 2010 - v4
    Checksum:iAE53B1157A37657D
    GO
    Isoform A (identifier: P18583-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         687-687: V → Q
         688-1006: Missing.
         2410-2426: RNGALTRPNCMFFLNRY → INGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR

    Show »
    Length:2,140
    Mass (Da):232,307
    Checksum:iADE72D9D269A914D
    GO
    Isoform B (identifier: P18583-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2220-2303: PVDISTAMSE...KKDQFLRAAP → GRVKRQGRVR...SRLYSSRFWW
         2304-2426: Missing.

    Show »
    Length:2,303
    Mass (Da):250,388
    Checksum:iC417A8F16219C1E1
    GO
    Isoform C (identifier: P18583-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2296-2325: DQFLRAAPVTGGMGAVLMRKMGWREGEGLG → GQILVAVFLPRSVPAVLFTTLLLPRPRISS
         2326-2426: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:2,325
    Mass (Da):252,254
    Checksum:iDEB57EC4B540649C
    GO
    Isoform D (identifier: P18583-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2410-2426: RNGALTRPNCMFFLNRY → INGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR

    Show »
    Length:2,459
    Mass (Da):267,035
    Checksum:i1C16840BD08A27F7
    GO
    Isoform E (identifier: P18583-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2108-2108: K → F
         2109-2426: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:2,108
    Mass (Da):228,181
    Checksum:iC1546DDB5FFDBB5E
    GO
    Isoform G (identifier: P18583-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         748-787: Missing.

    Show »
    Length:2,386
    Mass (Da):259,594
    Checksum:iD8DD6D8C39863B51
    GO
    Isoform H (identifier: P18583-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         687-689: VAQ → NVP
         690-2416: Missing.

    Show »
    Length:699
    Mass (Da):73,884
    Checksum:i38D999DC96C00502
    GO
    Isoform I (identifier: P18583-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         770-770: S → SMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSS

    Show »
    Length:2,466
    Mass (Da):268,093
    Checksum:i0BCC85FEA1FACFBE
    GO
    Isoform J (identifier: P18583-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2257-2282: IDAWAQLNSIPGQFTGSTGVQVLTQE → VCSSFLKKIIIYHQPTHTNVPVLMSK
         2283-2426: Missing.

    Show »
    Length:2,282
    Mass (Da):247,823
    Checksum:iE3951A6A0E3C5DED
    GO

    Sequence cautioni

    The sequence AAH02422.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence CAC69885.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.
    The sequence CAA44793.1 differs from that shown. Reason: Frameshift at positions 2315, 2412 and 2417.
    The sequence BAA82971.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti126 – 1261E → K in BAB14985. (PubMed:14702039)Curated
    Sequence conflicti129 – 1291Y → K in BAB14985. (PubMed:14702039)Curated
    Sequence conflicti1402 – 14021Y → S in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti1495 – 14951N → I in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti1538 – 15381N → S in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti1643 – 16431I → II in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti1692 – 16921L → I in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti1693 – 16931A → R in AAA36624. (PubMed:3054499)Curated
    Sequence conflicti1820 – 18212SS → PH in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti1820 – 18212SS → PH in AAA36624. (PubMed:3054499)Curated
    Sequence conflicti1939 – 19391R → S in AAD50078. (PubMed:10509013)Curated
    Sequence conflicti2090 – 20901E → V in AAK07692. (PubMed:11306577)Curated
    Sequence conflicti2090 – 20901E → V in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti2148 – 21481P → F in AAK07692. (PubMed:11306577)Curated
    Sequence conflicti2148 – 21481P → F in CAA45282. (PubMed:1435773)Curated
    Sequence conflicti2413 – 24164ALTR → SPYQ in AAK07692. (PubMed:11306577)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti473 – 4731P → S.6 Publications
    Corresponds to variant rs35622138 [ dbSNP | Ensembl ].
    VAR_065456
    Natural varianti555 – 5551T → M.
    Corresponds to variant rs13049658 [ dbSNP | Ensembl ].
    VAR_065457
    Natural varianti870 – 8701T → A.
    Corresponds to variant rs11908823 [ dbSNP | Ensembl ].
    VAR_056990
    Natural varianti1202 – 12021S → L.5 Publications
    Corresponds to variant rs13433428 [ dbSNP | Ensembl ].
    VAR_065458
    Natural varianti1575 – 15751R → C.3 Publications
    Corresponds to variant rs13047599 [ dbSNP | Ensembl ].
    VAR_056991

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei687 – 6893VAQ → NVP in isoform H. 1 PublicationVSP_004411
    Alternative sequencei687 – 6871V → Q in isoform A. 3 PublicationsVSP_004401
    Alternative sequencei688 – 1006319Missing in isoform A. 3 PublicationsVSP_004402Add
    BLAST
    Alternative sequencei690 – 24161727Missing in isoform H. 1 PublicationVSP_004412Add
    BLAST
    Alternative sequencei748 – 78740Missing in isoform G. 1 PublicationVSP_004410Add
    BLAST
    Alternative sequencei770 – 7701S → SMDSQMLASNTMDSQMLASN TMDSQMLASSTMDSQMLATS S in isoform I. 1 PublicationVSP_004413
    Alternative sequencei2108 – 21081K → F in isoform E. 1 PublicationVSP_004408
    Alternative sequencei2109 – 2426318Missing in isoform E. 1 PublicationVSP_004409Add
    BLAST
    Alternative sequencei2220 – 230384PVDIS…LRAAP → GRVKRQGRVRRQMKQPAASH LTVTRCNSLCGTKPQSEKHR IAENSVITSLPNIGPSLHLW EGSPRYNYLASRFASRLYSS RFWW in isoform B. 2 PublicationsVSP_004404Add
    BLAST
    Alternative sequencei2257 – 228226IDAWA…VLTQE → VCSSFLKKIIIYHQPTHTNV PVLMSK in isoform J. 1 PublicationVSP_004414Add
    BLAST
    Alternative sequencei2283 – 2426144Missing in isoform J. 1 PublicationVSP_004415Add
    BLAST
    Alternative sequencei2296 – 232530DQFLR…GEGLG → GQILVAVFLPRSVPAVLFTT LLLPRPRISS in isoform C. 1 PublicationVSP_004406Add
    BLAST
    Alternative sequencei2304 – 2426123Missing in isoform B. 2 PublicationsVSP_004405Add
    BLAST
    Alternative sequencei2326 – 2426101Missing in isoform C. 1 PublicationVSP_004407Add
    BLAST
    Alternative sequencei2410 – 242617RNGAL…FLNRY → INGSAYQPSFASPNKKHAKA TAATVVLQAMGLVPKDLMAN ATCFRSASRR in isoform A and isoform D. 3 PublicationsVSP_004403Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF380179 mRNA. Translation: AAL34497.1.
    AF380180 mRNA. Translation: AAL34498.1.
    AF380181 mRNA. Translation: AAL34499.1.
    AF380182 mRNA. Translation: AAL34500.1.
    AF380183 mRNA. Translation: AAL34501.1.
    AF380184 mRNA. Translation: AAL34502.1.
    AY026895 mRNA. Translation: AAK07692.1.
    AB028942 mRNA. Translation: BAA82971.2. Different initiation.
    AP000303 Genomic DNA. No translation available.
    AP000304 Genomic DNA. No translation available.
    CH471079 Genomic DNA. Translation: EAX09814.1.
    CH471079 Genomic DNA. Translation: EAX09818.1.
    CH471079 Genomic DNA. Translation: EAX09821.1.
    CH471079 Genomic DNA. Translation: EAX09823.1.
    AF435977 mRNA. Translation: AAL30810.1.
    AK024752 mRNA. Translation: BAB14985.1.
    AF161428 mRNA. Translation: AAF28988.1.
    AF161430 mRNA. Translation: AAF28990.1.
    BC002422 mRNA. Translation: AAH02422.1. Sequence problems.
    X63751 mRNA. Translation: CAC69885.1. Sequence problems.
    X63753 mRNA. Translation: CAA45282.1.
    X63071 mRNA. Translation: CAA44793.1. Frameshift.
    M36428 Genomic DNA. Translation: AAA36624.1.
    AF139897 mRNA. Translation: AAD50078.1.
    CCDSiCCDS13629.1. [P18583-1]
    CCDS13631.1. [P18583-3]
    PIRiS26650.
    RefSeqiNP_001278340.1. NM_001291411.1.
    NP_001278341.1. NM_001291412.1.
    NP_115571.2. NM_032195.2.
    NP_620305.2. NM_138927.2.
    XP_006724106.1. XM_006724043.1. [P18583-5]
    UniGeneiHs.517262.
    Hs.656725.

    Genome annotation databases

    EnsembliENST00000300278; ENSP00000300278; ENSG00000159140. [P18583-3]
    ENST00000356577; ENSP00000348984; ENSG00000159140. [P18583-1]
    ENST00000381679; ENSP00000371095; ENSG00000159140. [P18583-6]
    ENST00000455528; ENSP00000399783; ENSG00000159140. [P18583-4]
    GeneIDi6651.
    KEGGihsa:6651.
    UCSCiuc002ysb.1. human. [P18583-6]
    uc002ysc.3. human. [P18583-3]
    uc002yse.1. human. [P18583-1]
    uc002ysg.3. human. [P18583-10]

    Polymorphism databases

    DMDMi296453022.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF380179 mRNA. Translation: AAL34497.1 .
    AF380180 mRNA. Translation: AAL34498.1 .
    AF380181 mRNA. Translation: AAL34499.1 .
    AF380182 mRNA. Translation: AAL34500.1 .
    AF380183 mRNA. Translation: AAL34501.1 .
    AF380184 mRNA. Translation: AAL34502.1 .
    AY026895 mRNA. Translation: AAK07692.1 .
    AB028942 mRNA. Translation: BAA82971.2 . Different initiation.
    AP000303 Genomic DNA. No translation available.
    AP000304 Genomic DNA. No translation available.
    CH471079 Genomic DNA. Translation: EAX09814.1 .
    CH471079 Genomic DNA. Translation: EAX09818.1 .
    CH471079 Genomic DNA. Translation: EAX09821.1 .
    CH471079 Genomic DNA. Translation: EAX09823.1 .
    AF435977 mRNA. Translation: AAL30810.1 .
    AK024752 mRNA. Translation: BAB14985.1 .
    AF161428 mRNA. Translation: AAF28988.1 .
    AF161430 mRNA. Translation: AAF28990.1 .
    BC002422 mRNA. Translation: AAH02422.1 . Sequence problems.
    X63751 mRNA. Translation: CAC69885.1 . Sequence problems.
    X63753 mRNA. Translation: CAA45282.1 .
    X63071 mRNA. Translation: CAA44793.1 . Frameshift.
    M36428 Genomic DNA. Translation: AAA36624.1 .
    AF139897 mRNA. Translation: AAD50078.1 .
    CCDSi CCDS13629.1. [P18583-1 ]
    CCDS13631.1. [P18583-3 ]
    PIRi S26650.
    RefSeqi NP_001278340.1. NM_001291411.1.
    NP_001278341.1. NM_001291412.1.
    NP_115571.2. NM_032195.2.
    NP_620305.2. NM_138927.2.
    XP_006724106.1. XM_006724043.1. [P18583-5 ]
    UniGenei Hs.517262.
    Hs.656725.

    3D structure databases

    ProteinModelPortali P18583.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112534. 64 interactions.
    DIPi DIP-42289N.
    IntActi P18583. 16 interactions.
    MINTi MINT-1200716.

    Protein family/group databases

    TCDBi 3.A.18.1.1. the nuclear mrna exporter (mrna-e) family.

    PTM databases

    PhosphoSitei P18583.

    Polymorphism databases

    DMDMi 296453022.

    Proteomic databases

    MaxQBi P18583.
    PaxDbi P18583.
    PRIDEi P18583.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000300278 ; ENSP00000300278 ; ENSG00000159140 . [P18583-3 ]
    ENST00000356577 ; ENSP00000348984 ; ENSG00000159140 . [P18583-1 ]
    ENST00000381679 ; ENSP00000371095 ; ENSG00000159140 . [P18583-6 ]
    ENST00000455528 ; ENSP00000399783 ; ENSG00000159140 . [P18583-4 ]
    GeneIDi 6651.
    KEGGi hsa:6651.
    UCSCi uc002ysb.1. human. [P18583-6 ]
    uc002ysc.3. human. [P18583-3 ]
    uc002yse.1. human. [P18583-1 ]
    uc002ysg.3. human. [P18583-10 ]

    Organism-specific databases

    CTDi 6651.
    GeneCardsi GC21P034914.
    H-InvDB HIX0175054.
    HIX0175117.
    HGNCi HGNC:11183. SON.
    HPAi HPA023535.
    HPA031755.
    HPA031756.
    MIMi 182465. gene.
    neXtProti NX_P18583.
    PharmGKBi PA36020.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG254690.
    HOVERGENi HBG023160.
    InParanoidi P18583.
    OMAi EIPTKKS.
    OrthoDBi EOG73NG3J.
    PhylomeDBi P18583.
    TreeFami TF330344.

    Miscellaneous databases

    ChiTaRSi SON. human.
    GeneWikii SON.
    GenomeRNAii 6651.
    NextBioi 25923.
    PROi P18583.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P18583.
    Bgeei P18583.
    Genevestigatori P18583.

    Family and domain databases

    Gene3Di 3.30.160.20. 1 hit.
    InterProi IPR014720. dsRNA-bd_dom.
    IPR000467. G_patch_dom.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF01585. G-patch. 1 hit.
    [Graphical view ]
    SMARTi SM00443. G_patch. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS50137. DS_RBD. 1 hit.
    PS50174. G_PATCH. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map."
      Reymond A., Friedli M., Neergaard Henrichsen C., Chapot F., Deutsch S., Ucla C., Rossier C., Lyle R., Guipponi M., Antonarakis S.E.
      Genomics 78:46-54(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E AND F), VARIANTS SER-473; SER-473 AND LEU-1202.
    2. "Transcription repression of human hepatitis B virus genes by negative regulatory element-binding protein/SON."
      Sun C.-T., Lo W.-Y., Wang I.-H., Lo Y.-H., Shiou S.-R., Lai C.-K., Ting L.-P.
      J. Biol. Chem. 276:24059-24067(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM G), VARIANTS SER-473 AND LEU-1202; CYS-1575.
      Tissue: Liver.
    3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), VARIANTS SER-473 AND LEU-1202; CYS-1575.
      Tissue: Brain.
    4. "The DNA sequence of human chromosome 21."
      Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
      , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
      Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-473.
    6. "mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs."
      Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M.
      Gene 321:185-193(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-689 (ISOFORM H).
      Tissue: Placenta.
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130.
      Tissue: Smooth muscle.
    8. "Human partial CDS from CD34+ stem cells."
      Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-114, VARIANT CYS-1575.
      Tissue: Umbilical cord blood.
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 544-1903.
      Tissue: Brain.
    10. "Identification of a protein product of a novel human gene SON and the biological effect upon administering a changed form of this gene into mammalian cells."
      Chumakov I.M., Berdichevskii F.B., Sokolova N.V., Reznikov M.V., Prasolov V.S.
      Mol. Biol. (Mosk.) 25:731-740(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 554-2426 (ISOFORM A).
    11. "The human SON gene: the large and small transcripts contains various 5'-terminal sequences."
      Bliskovskii V.V., Kirillov A.V., Zakhariev V.M., Chumakov I.M.
      Mol. Biol. (Mosk.) 26:807-812(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-1079 (ISOFORM I).
      Tissue: Placenta.
    12. "Coding part of the son gene small transcript contains four areas of complete tandem repeats."
      Bliskovskii V.V., Berdichevskii F.B., Tkachenko A.V., Belova M.E., Chumakov I.M.
      Mol. Biol. (Mosk.) 26:793-806(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1009-2426 (ISOFORMS A/D), VARIANTS SER-473 AND LEU-1202.
      Tissue: Placenta.
    13. "A cDNA clone for a novel nuclear protein with DNA binding activity."
      Mattioni T., Hume C.R., Konigorski S., Hayes P., Osterweil Z., Lee J.S.
      Chromosoma 101:618-624(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1145-2426 (ISOFORM F), SUBCELLULAR LOCATION, VARIANTS SER-473 AND LEU-1202.
    14. "Decoding of the primary structure of the son3 region in human genome: identification of a new protein with unusual structure and homology with DNA-binding proteins."
      Berdichevskii F.B., Chumakov I.M., Kiselev L.L.
      Mol. Biol. (Mosk.) 22:794-801(1988) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1693-2175 (ISOFORM A).
    15. "A selection system for human apoptosis inhibitors using yeast."
      Greenhalf W., Lee J., Chaudhuri B.
      Yeast 15:1307-1321(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1939-2426 (ISOFORM J).
      Tissue: Cerebellum.
    16. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
    17. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1697, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    18. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-1556; SER-1697; SER-1783; SER-1948 AND SER-1950, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    19. "Disruption of the NHR4 domain structure in AML1-ETO abrogates SON binding and promotes leukemogenesis."
      Ahn E.Y., Yan M., Malakhova O.A., Lo M.C., Boyapati A., Ommen H.B., Hines R., Hokland P., Zhang D.E.
      Proc. Natl. Acad. Sci. U.S.A. 105:17103-17108(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH AML1-MTG8 FUSION PROTEIN.
    20. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    21. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154; SER-283 AND SER-1556, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    22. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-16; LYS-288 AND LYS-2055, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    23. "SON is a spliceosome-associated factor required for mitotic progression."
      Huen M.S., Sy S.M., Leung K.M., Ching Y.P., Tipoe G.L., Man C., Dong S., Chen J.
      Cell Cycle 9:2679-2685(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH THE SPLICEOSOME.
    24. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94; SER-142; SER-152; SER-154; SER-283; SER-1697; SER-1769; SER-2009; SER-2011; SER-2013 AND THR-2163, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    25. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    26. "SON controls cell-cycle progression by coordinated regulation of RNA splicing."
      Ahn E.Y., Dekelver R.C., Lo M.C., Nguyen T.A., Matsuura S., Boyapati A., Pandit S., Fu X.D., Zhang D.E.
      Mol. Cell 42:185-198(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, RNA-BINDING, INTERACTION WITH SRSF2.
    27. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154; SER-160; SER-283; SER-1556; SER-1697; SER-1769; SER-2011 AND SER-2013, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    28. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSON_HUMAN
    AccessioniPrimary (citable) accession number: P18583
    Secondary accession number(s): D3DSF5
    , D3DSF6, E7ETE8, E7EU67, E7EVW3, E9PFQ2, O14487, O95981, Q14120, Q6PKE0, Q9H7B1, Q9P070, Q9P072, Q9UKP9, Q9UPY0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1990
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 150 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 21
      Human chromosome 21: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3