Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P18583

- SON_HUMAN

UniProt

P18583 - SON_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein SON

Gene

SON

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

RNA-binding protein that acts as a mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites. Specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG. Probably acts by facilitating the interaction between Serine/arginine-rich proteins such as SRSF2 and the RNA polymerase II. Also binds to DNA; binds to the consensus DNA sequence: 5'-GA[GT]AN[CG][AG]CC-3'. May indirectly repress hepatitis B virus (HBV) core promoter activity and transcription of HBV genes and production of HBV virions.2 Publications

GO - Molecular functioni

  1. DNA binding Source: ProtInc
  2. nucleic acid binding Source: UniProtKB
  3. poly(A) RNA binding Source: UniProtKB
  4. RNA binding Source: UniProtKB

GO - Biological processi

  1. cytokinesis Source: UniProtKB
  2. microtubule cytoskeleton organization Source: UniProtKB
  3. mRNA processing Source: UniProtKB
  4. negative regulation of apoptotic process Source: UniProtKB
  5. regulation of cell cycle Source: UniProtKB
  6. regulation of RNA splicing Source: UniProtKB
  7. RNA splicing Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell cycle, mRNA processing, mRNA splicing

Keywords - Ligandi

DNA-binding, RNA-binding

Protein family/group databases

TCDBi3.A.18.1.1. the nuclear mrna exporter (mrna-e) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SON
Alternative name(s):
Bax antagonist selected in saccharomyces 1
Short name:
BASS1
Negative regulatory element-binding protein
Short name:
NRE-binding protein
Protein DBP-5
SON3
Gene namesi
Name:SON
Synonyms:C21orf50, DBP5, KIAA1019, NREBP
ORF Names:HSPC310, HSPC312
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 21

Organism-specific databases

HGNCiHGNC:11183. SON.

Subcellular locationi

Nucleus speckle 2 Publications
Note: Colocalizes with the pre-mRNA splicing factor SRSF2.

GO - Cellular componenti

  1. nuclear speck Source: UniProtKB
  2. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36020.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed2 Publications
Chaini2 – 24262425Protein SONPRO_0000072037Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine2 Publications
Modified residuei16 – 161N6-acetyllysine1 Publication
Modified residuei94 – 941Phosphoserine1 Publication
Modified residuei142 – 1421Phosphoserine1 Publication
Modified residuei152 – 1521Phosphoserine4 Publications
Modified residuei154 – 1541Phosphoserine3 Publications
Modified residuei160 – 1601Phosphoserine1 Publication
Modified residuei283 – 2831Phosphoserine3 Publications
Modified residuei288 – 2881N6-acetyllysine1 Publication
Modified residuei1556 – 15561Phosphoserine3 Publications
Modified residuei1697 – 16971Phosphoserine4 Publications
Modified residuei1769 – 17691Phosphoserine2 Publications
Modified residuei1783 – 17831Phosphoserine1 Publication
Modified residuei1948 – 19481Phosphoserine1 Publication
Modified residuei1950 – 19501Phosphoserine1 Publication
Modified residuei2009 – 20091Phosphoserine1 Publication
Modified residuei2011 – 20111Phosphoserine2 Publications
Modified residuei2013 – 20131Phosphoserine2 Publications
Modified residuei2055 – 20551N6-acetyllysine1 Publication
Modified residuei2163 – 21631Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP18583.
PaxDbiP18583.
PRIDEiP18583.

PTM databases

PhosphoSiteiP18583.

Expressioni

Tissue specificityi

Widely expressed, with the higher expression seen in leukocyte and heart.

Gene expression databases

BgeeiP18583.
ExpressionAtlasiP18583. baseline and differential.
GenevestigatoriP18583.

Organism-specific databases

HPAiHPA023535.
HPA031755.
HPA031756.

Interactioni

Subunit structurei

Interacts with SRSF2. Associates with the spliceosome. Interacts with the AML1-MTG8 (AML1-ETO) fusion protein, possibly leading to trigger signals inhibiting leukemogenesis.3 Publications

Protein-protein interaction databases

BioGridi112534. 67 interactions.
DIPiDIP-42289N.
IntActiP18583. 16 interactions.
MINTiMINT-1200716.

Structurei

3D structure databases

ProteinModelPortaliP18583.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati1006 – 101161-1
Repeati1014 – 101961-2
Repeati1021 – 102661-3
Repeati1030 – 103561-4
Repeati1038 – 104361-5
Repeati1046 – 105161-6
Repeati1055 – 106061-7
Repeati1063 – 106861-8
Repeati1071 – 107661-9
Repeati1080 – 108561-10
Repeati1089 – 109461-11
Repeati1100 – 110561-12
Repeati1111 – 111661-13
Repeati1121 – 112661-14
Repeati1925 – 193172-1
Repeati1934 – 1952193-1Add
BLAST
Repeati1953 – 195972-2
Repeati1960 – 196672-3
Repeati1967 – 197372-4
Repeati1974 – 198072-5
Repeati1981 – 198772-6
Repeati1988 – 199472-7
Repeati1995 – 2013193-2Add
BLAST
Domaini2305 – 235147G-patchPROSITE-ProRule annotationAdd
BLAST
Domaini2371 – 242656DRBMPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni726 – 89517017 X 10 AA tandem repeats of L-A-[ST]-[NSG]-[TS]-MDSQMAdd
BLAST
Regioni912 – 9887711 X 7 AA tandem repeats of [DR]-P-Y-R-[LI][AG][QHP]Add
BLAST
Regioni1006 – 112612114 X 6 AA repeats of [ED]-R-S-M-M-SAdd
BLAST
Regioni1147 – 1179333 X 11 AA tandem repats of P-P-L-P-P-E-E-P-P-[TME]-[MTG]Add
BLAST
Regioni1359 – 1390324 X 8 AA tandem repeats of V-L-E-SS-[AVT]-VTAdd
BLAST
Regioni1925 – 1994707 X 7 AA repeats of P-S-R-R-S-R-[TS]Add
BLAST
Regioni1934 – 2013802 X 19 AA repeats of P-S-R-R-R-R-S-R-S-V-V-R-R-R-S-F-S-I-SAdd
BLAST
Regioni2013 – 2039273 X tandem repeats of [ST]-P-[VLI]-R-[RL]-[RK]-[RF]-S-RAdd
BLAST

Domaini

Sequence similaritiesi

Contains 1 DRBM (double-stranded RNA-binding) domain.PROSITE-ProRule annotation
Contains 1 G-patch domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG254690.
GeneTreeiENSGT00730000111141.
HOVERGENiHBG023160.
InParanoidiP18583.
OMAiEIPTKKS.
OrthoDBiEOG73NG3J.
PhylomeDBiP18583.
TreeFamiTF330344.

Family and domain databases

Gene3Di3.30.160.20. 1 hit.
InterProiIPR014720. dsRNA-bd_dom.
IPR000467. G_patch_dom.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF01585. G-patch. 1 hit.
[Graphical view]
SMARTiSM00443. G_patch. 1 hit.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50137. DS_RBD. 1 hit.
PS50174. G_PATCH. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform F (identifier: P18583-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATNIEQIFR SFVVSKFREI QQELSSGRNE GQLNGETNTP IEGNQAGDAA
60 70 80 90 100
ASARSLPNEE IVQKIEEVLS GVLDTELRYK PDLKEGSRKS RCVSVQTDPT
110 120 130 140 150
DEIPTKKSKK HKKHKNKKKK KKKEKEKKYK RQPEESESKT KSHDDGNIDL
160 170 180 190 200
ESDSFLKFDS EPSAVALELP TRAFGPSETN ESPAVVLEPP VVSMEVSEPH
210 220 230 240 250
ILETLKPATK TAELSVVSTS VISEQSEQSV AVMPEPSMTK ILDSFAAAPV
260 270 280 290 300
PTTTLVLKSS EPVVTMSVEY QMKSVLKSVE STSPEPSKIM LVEPPVAKVL
310 320 330 340 350
EPSETLVVSS ETPTEVYPEP STSTTMDFPE SSAIEALRLP EQPVDVPSEI
360 370 380 390 400
ADSSMTRPQE LPELPKTTAL ELQESSVASA MELPGPPATS MPELQGPPVT
410 420 430 440 450
PVLELPGPSA TPVPELPGPL STPVPELPGP PATAVPELPG PSVTPVPQLS
460 470 480 490 500
QELPGLPAPS MGLEPPQEVP EPPVMAQELP GLPLVTAAVE LPEQPAVTVA
510 520 530 540 550
MELTEQPVTT TELEQPVGMT TVEHPGHPEV TTATGLLGQP EATMVLELPG
560 570 580 590 600
QPVATTALEL PGQPSVTGVP ELPGLPSATR ALELSGQPVA TGALELPGPL
610 620 630 640 650
MAAGALEFSG QSGAAGALEL LGQPLATGVL ELPGQPGAPE LPGQPVATVA
660 670 680 690 700
LEISVQSVVT TSELSTMTVS QSLEVPSTTA LESYNTVAQE LPTTLVGETS
710 720 730 740 750
VTVGVDPLMA PESHILASNT METHILASNT MDSQMLASNT MDSQMLASNT
760 770 780 790 800
MDSQMLASST MDSQMLATSS MDSQMLATSS MDSQMLATST MDSQMLATSS
810 820 830 840 850
MDSQMLATSS MDSQMLATSS MDSQMLATSS MDSQMLATST MDSQMLATST
860 870 880 890 900
MDSQMLATSS MDSQMLASGT MDSQMLASGT MDAQMLASGT MDAQMLASST
910 920 930 940 950
QDSAMLGSKS PDPYRLAQDP YRLAQDPYRL GHDPYRLGHD AYRLGQDPYR
960 970 980 990 1000
LGHDPYRLTP DPYRMSPRPY RIAPRSYRIA PRPYRLAPRP LMLASRRSMM
1010 1020 1030 1040 1050
MSYAAERSMM SSYERSMMSY ERSMMSPMAE RSMMSAYERS MMSAYERSMM
1060 1070 1080 1090 1100
SPMAERSMMS AYERSMMSAY ERSMMSPMAD RSMMSMGADR SMMSSYSAAD
1110 1120 1130 1140 1150
RSMMSSYSAA DRSMMSSYTA DRSMMSMAAD SYTDSYTDTY TEAYMVPPLP
1160 1170 1180 1190 1200
PEEPPTMPPL PPEEPPMTPP LPPEEPPEGP ALPTEQSALT AENTWPTEVP
1210 1220 1230 1240 1250
SSPSEESVSQ PEPPVSQSEI SEPSAVPTDY SVSASDPSVL VSEAAVTVPE
1260 1270 1280 1290 1300
PPPEPESSIT LTPVESAVVA EEHEVVPERP VTCMVSETPA MSAEPTVLAS
1310 1320 1330 1340 1350
EPPVMSETAE TFDSMRASGH VASEVSTSLL VPAVTTPVLA ESILEPPAMA
1360 1370 1380 1390 1400
APESSAMAVL ESSAVTVLES STVTVLESST VTVLEPSVVT VPEPPVVAEP
1410 1420 1430 1440 1450
DYVTIPVPVV SALEPSVPVL EPAVSVLQPS MIVSEPSVSV QESTVTVSEP
1460 1470 1480 1490 1500
AVTVSEQTQV IPTEVAIEST PMILESSIMS SHVMKGINLS SGDQNLAPEI
1510 1520 1530 1540 1550
GMQEIALHSG EEPHAEEHLK GDFYESEHGI NIDLNINNHL IAKEMEHNTV
1560 1570 1580 1590 1600
CAAGTSPVGE IGEEKILPTS ETKQRTVLDT YPGVSEADAG ETLSSTGPFA
1610 1620 1630 1640 1650
LEPDATGTSK GIEFTTASTL SLVNKYDVDL SLTTQDTEHD MVISTSPSGG
1660 1670 1680 1690 1700
SEADIEGPLP AKDIHLDLPS NNNLVSKDTE EPLPVKESDQ TLAALLSPKE
1710 1720 1730 1740 1750
SSGGEKEVPP PPKETLPDSG FSANIEDINE ADLVRPLLPK DMERLTSLRA
1760 1770 1780 1790 1800
GIEGPLLASD VGRDRSAASP VVSSMPERAS ESSSEEKDDY EIFVKVKDTH
1810 1820 1830 1840 1850
EKSKKNKNRD KGEKEKKRDS SLRSRSKRSK SSEHKSRKRT SESRSRARKR
1860 1870 1880 1890 1900
SSKSKSHRSQ TRSRSRSRRR RRSSRSRSKS RGRRSVSKEK RKRSPKHRSK
1910 1920 1930 1940 1950
SRERKRKRSS SRDNRKTVRA RSRTPSRRSR SHTPSRRRRS RSVGRRRSFS
1960 1970 1980 1990 2000
ISPSRRSRTP SRRSRTPSRR SRTPSRRSRT PSRRSRTPSR RSRTPSRRRR
2010 2020 2030 2040 2050
SRSVVRRRSF SISPVRLRRS RTPLRRRFSR SPIRRKRSRS SERGRSPKRL
2060 2070 2080 2090 2100
TDLDKAQLLE IAKANAAAMC AKAGVPLPPN LKPAPPPTIE EKVAKKSGGA
2110 2120 2130 2140 2150
TIEELTEKCK QIAQSKEDDD VIVNKPHVSD EEEEEPPFYH HPFKLSEPKP
2160 2170 2180 2190 2200
IFFNLNIAAA KPTPPKSQVT LTKEFPVSSG SQHRKKEADS VYGEWVPVEK
2210 2220 2230 2240 2250
NGEENKDDDN VFSSNLPSEP VDISTAMSER ALAQKRLSEN AFDLEAMSML
2260 2270 2280 2290 2300
NRAQERIDAW AQLNSIPGQF TGSTGVQVLT QEQLANTGAQ AWIKKDQFLR
2310 2320 2330 2340 2350
AAPVTGGMGA VLMRKMGWRE GEGLGKNKEG NKEPILVDFK TDRKGLVAVG
2360 2370 2380 2390 2400
ERAQKRSGNF SAAMKDLSGK HPVSALMEIC NKRRWQPPEF LLVHDSGPDH
2410 2420
RKHFLFRVLR NGALTRPNCM FFLNRY
Length:2,426
Mass (Da):263,830
Last modified:May 18, 2010 - v4
Checksum:iAE53B1157A37657D
GO
Isoform A (identifier: P18583-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-687: V → Q
     688-1006: Missing.
     2410-2426: RNGALTRPNCMFFLNRY → INGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR

Show »
Length:2,140
Mass (Da):232,307
Checksum:iADE72D9D269A914D
GO
Isoform B (identifier: P18583-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2220-2303: PVDISTAMSE...KKDQFLRAAP → GRVKRQGRVR...SRLYSSRFWW
     2304-2426: Missing.

Show »
Length:2,303
Mass (Da):250,388
Checksum:iC417A8F16219C1E1
GO
Isoform C (identifier: P18583-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2296-2325: DQFLRAAPVTGGMGAVLMRKMGWREGEGLG → GQILVAVFLPRSVPAVLFTTLLLPRPRISS
     2326-2426: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:2,325
Mass (Da):252,254
Checksum:iDEB57EC4B540649C
GO
Isoform D (identifier: P18583-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2410-2426: RNGALTRPNCMFFLNRY → INGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR

Show »
Length:2,459
Mass (Da):267,035
Checksum:i1C16840BD08A27F7
GO
Isoform E (identifier: P18583-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2108-2108: K → F
     2109-2426: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:2,108
Mass (Da):228,181
Checksum:iC1546DDB5FFDBB5E
GO
Isoform G (identifier: P18583-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     748-787: Missing.

Show »
Length:2,386
Mass (Da):259,594
Checksum:iD8DD6D8C39863B51
GO
Isoform H (identifier: P18583-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-689: VAQ → NVP
     690-2416: Missing.

Show »
Length:699
Mass (Da):73,884
Checksum:i38D999DC96C00502
GO
Isoform I (identifier: P18583-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     770-770: S → SMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSS

Show »
Length:2,466
Mass (Da):268,093
Checksum:i0BCC85FEA1FACFBE
GO
Isoform J (identifier: P18583-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2257-2282: IDAWAQLNSIPGQFTGSTGVQVLTQE → VCSSFLKKIIIYHQPTHTNVPVLMSK
     2283-2426: Missing.

Show »
Length:2,282
Mass (Da):247,823
Checksum:iE3951A6A0E3C5DED
GO

Sequence cautioni

The sequence AAH02422.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA82971.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA44793.1 differs from that shown. Reason: Frameshift at positions 2315, 2412 and 2417. Curated
The sequence CAC69885.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti126 – 1261E → K in BAB14985. (PubMed:14702039)Curated
Sequence conflicti129 – 1291Y → K in BAB14985. (PubMed:14702039)Curated
Sequence conflicti1402 – 14021Y → S in CAA45282. (PubMed:1435773)Curated
Sequence conflicti1495 – 14951N → I in CAA45282. (PubMed:1435773)Curated
Sequence conflicti1538 – 15381N → S in CAA45282. (PubMed:1435773)Curated
Sequence conflicti1643 – 16431I → II in CAA45282. (PubMed:1435773)Curated
Sequence conflicti1692 – 16921L → I in CAA45282. (PubMed:1435773)Curated
Sequence conflicti1693 – 16931A → R in AAA36624. (PubMed:3054499)Curated
Sequence conflicti1820 – 18212SS → PH in CAA45282. (PubMed:1435773)Curated
Sequence conflicti1820 – 18212SS → PH in AAA36624. (PubMed:3054499)Curated
Sequence conflicti1939 – 19391R → S in AAD50078. (PubMed:10509013)Curated
Sequence conflicti2090 – 20901E → V in AAK07692. (PubMed:11306577)Curated
Sequence conflicti2090 – 20901E → V in CAA45282. (PubMed:1435773)Curated
Sequence conflicti2148 – 21481P → F in AAK07692. (PubMed:11306577)Curated
Sequence conflicti2148 – 21481P → F in CAA45282. (PubMed:1435773)Curated
Sequence conflicti2413 – 24164ALTR → SPYQ in AAK07692. (PubMed:11306577)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti473 – 4731P → S.6 Publications
Corresponds to variant rs35622138 [ dbSNP | Ensembl ].
VAR_065456
Natural varianti555 – 5551T → M.
Corresponds to variant rs13049658 [ dbSNP | Ensembl ].
VAR_065457
Natural varianti870 – 8701T → A.
Corresponds to variant rs11908823 [ dbSNP | Ensembl ].
VAR_056990
Natural varianti1202 – 12021S → L.5 Publications
Corresponds to variant rs13433428 [ dbSNP | Ensembl ].
VAR_065458
Natural varianti1575 – 15751R → C.3 Publications
Corresponds to variant rs13047599 [ dbSNP | Ensembl ].
VAR_056991

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei687 – 6893VAQ → NVP in isoform H. 1 PublicationVSP_004411
Alternative sequencei687 – 6871V → Q in isoform A. 3 PublicationsVSP_004401
Alternative sequencei688 – 1006319Missing in isoform A. 3 PublicationsVSP_004402Add
BLAST
Alternative sequencei690 – 24161727Missing in isoform H. 1 PublicationVSP_004412Add
BLAST
Alternative sequencei748 – 78740Missing in isoform G. 1 PublicationVSP_004410Add
BLAST
Alternative sequencei770 – 7701S → SMDSQMLASNTMDSQMLASN TMDSQMLASSTMDSQMLATS S in isoform I. 1 PublicationVSP_004413
Alternative sequencei2108 – 21081K → F in isoform E. 1 PublicationVSP_004408
Alternative sequencei2109 – 2426318Missing in isoform E. 1 PublicationVSP_004409Add
BLAST
Alternative sequencei2220 – 230384PVDIS…LRAAP → GRVKRQGRVRRQMKQPAASH LTVTRCNSLCGTKPQSEKHR IAENSVITSLPNIGPSLHLW EGSPRYNYLASRFASRLYSS RFWW in isoform B. 2 PublicationsVSP_004404Add
BLAST
Alternative sequencei2257 – 228226IDAWA…VLTQE → VCSSFLKKIIIYHQPTHTNV PVLMSK in isoform J. 1 PublicationVSP_004414Add
BLAST
Alternative sequencei2283 – 2426144Missing in isoform J. 1 PublicationVSP_004415Add
BLAST
Alternative sequencei2296 – 232530DQFLR…GEGLG → GQILVAVFLPRSVPAVLFTT LLLPRPRISS in isoform C. 1 PublicationVSP_004406Add
BLAST
Alternative sequencei2304 – 2426123Missing in isoform B. 2 PublicationsVSP_004405Add
BLAST
Alternative sequencei2326 – 2426101Missing in isoform C. 1 PublicationVSP_004407Add
BLAST
Alternative sequencei2410 – 242617RNGAL…FLNRY → INGSAYQPSFASPNKKHAKA TAATVVLQAMGLVPKDLMAN ATCFRSASRR in isoform A and isoform D. 3 PublicationsVSP_004403Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF380179 mRNA. Translation: AAL34497.1.
AF380180 mRNA. Translation: AAL34498.1.
AF380181 mRNA. Translation: AAL34499.1.
AF380182 mRNA. Translation: AAL34500.1.
AF380183 mRNA. Translation: AAL34501.1.
AF380184 mRNA. Translation: AAL34502.1.
AY026895 mRNA. Translation: AAK07692.1.
AB028942 mRNA. Translation: BAA82971.2. Different initiation.
AP000303 Genomic DNA. No translation available.
AP000304 Genomic DNA. No translation available.
CH471079 Genomic DNA. Translation: EAX09814.1.
CH471079 Genomic DNA. Translation: EAX09818.1.
CH471079 Genomic DNA. Translation: EAX09821.1.
CH471079 Genomic DNA. Translation: EAX09823.1.
AF435977 mRNA. Translation: AAL30810.1.
AK024752 mRNA. Translation: BAB14985.1.
AF161428 mRNA. Translation: AAF28988.1.
AF161430 mRNA. Translation: AAF28990.1.
BC002422 mRNA. Translation: AAH02422.1. Sequence problems.
X63751 mRNA. Translation: CAC69885.1. Sequence problems.
X63753 mRNA. Translation: CAA45282.1.
X63071 mRNA. Translation: CAA44793.1. Frameshift.
M36428 Genomic DNA. Translation: AAA36624.1.
AF139897 mRNA. Translation: AAD50078.1.
CCDSiCCDS13629.1. [P18583-1]
CCDS13631.1. [P18583-3]
CCDS74784.1. [P18583-6]
PIRiS26650.
RefSeqiNP_001278340.1. NM_001291411.1.
NP_001278341.1. NM_001291412.1.
NP_115571.2. NM_032195.2.
NP_620305.2. NM_138927.2.
XP_006724106.1. XM_006724043.1. [P18583-5]
UniGeneiHs.517262.
Hs.656725.

Genome annotation databases

EnsembliENST00000300278; ENSP00000300278; ENSG00000159140. [P18583-3]
ENST00000356577; ENSP00000348984; ENSG00000159140. [P18583-1]
ENST00000381679; ENSP00000371095; ENSG00000159140. [P18583-6]
ENST00000455528; ENSP00000399783; ENSG00000159140. [P18583-4]
GeneIDi6651.
KEGGihsa:6651.
UCSCiuc002ysb.1. human. [P18583-6]
uc002ysc.3. human. [P18583-3]
uc002yse.1. human. [P18583-1]
uc002ysg.3. human. [P18583-10]

Polymorphism databases

DMDMi296453022.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF380179 mRNA. Translation: AAL34497.1 .
AF380180 mRNA. Translation: AAL34498.1 .
AF380181 mRNA. Translation: AAL34499.1 .
AF380182 mRNA. Translation: AAL34500.1 .
AF380183 mRNA. Translation: AAL34501.1 .
AF380184 mRNA. Translation: AAL34502.1 .
AY026895 mRNA. Translation: AAK07692.1 .
AB028942 mRNA. Translation: BAA82971.2 . Different initiation.
AP000303 Genomic DNA. No translation available.
AP000304 Genomic DNA. No translation available.
CH471079 Genomic DNA. Translation: EAX09814.1 .
CH471079 Genomic DNA. Translation: EAX09818.1 .
CH471079 Genomic DNA. Translation: EAX09821.1 .
CH471079 Genomic DNA. Translation: EAX09823.1 .
AF435977 mRNA. Translation: AAL30810.1 .
AK024752 mRNA. Translation: BAB14985.1 .
AF161428 mRNA. Translation: AAF28988.1 .
AF161430 mRNA. Translation: AAF28990.1 .
BC002422 mRNA. Translation: AAH02422.1 . Sequence problems.
X63751 mRNA. Translation: CAC69885.1 . Sequence problems.
X63753 mRNA. Translation: CAA45282.1 .
X63071 mRNA. Translation: CAA44793.1 . Frameshift.
M36428 Genomic DNA. Translation: AAA36624.1 .
AF139897 mRNA. Translation: AAD50078.1 .
CCDSi CCDS13629.1. [P18583-1 ]
CCDS13631.1. [P18583-3 ]
CCDS74784.1. [P18583-6 ]
PIRi S26650.
RefSeqi NP_001278340.1. NM_001291411.1.
NP_001278341.1. NM_001291412.1.
NP_115571.2. NM_032195.2.
NP_620305.2. NM_138927.2.
XP_006724106.1. XM_006724043.1. [P18583-5 ]
UniGenei Hs.517262.
Hs.656725.

3D structure databases

ProteinModelPortali P18583.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112534. 67 interactions.
DIPi DIP-42289N.
IntActi P18583. 16 interactions.
MINTi MINT-1200716.

Protein family/group databases

TCDBi 3.A.18.1.1. the nuclear mrna exporter (mrna-e) family.

PTM databases

PhosphoSitei P18583.

Polymorphism databases

DMDMi 296453022.

Proteomic databases

MaxQBi P18583.
PaxDbi P18583.
PRIDEi P18583.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000300278 ; ENSP00000300278 ; ENSG00000159140 . [P18583-3 ]
ENST00000356577 ; ENSP00000348984 ; ENSG00000159140 . [P18583-1 ]
ENST00000381679 ; ENSP00000371095 ; ENSG00000159140 . [P18583-6 ]
ENST00000455528 ; ENSP00000399783 ; ENSG00000159140 . [P18583-4 ]
GeneIDi 6651.
KEGGi hsa:6651.
UCSCi uc002ysb.1. human. [P18583-6 ]
uc002ysc.3. human. [P18583-3 ]
uc002yse.1. human. [P18583-1 ]
uc002ysg.3. human. [P18583-10 ]

Organism-specific databases

CTDi 6651.
GeneCardsi GC21P034914.
H-InvDB HIX0175054.
HIX0175117.
HGNCi HGNC:11183. SON.
HPAi HPA023535.
HPA031755.
HPA031756.
MIMi 182465. gene.
neXtProti NX_P18583.
PharmGKBi PA36020.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG254690.
GeneTreei ENSGT00730000111141.
HOVERGENi HBG023160.
InParanoidi P18583.
OMAi EIPTKKS.
OrthoDBi EOG73NG3J.
PhylomeDBi P18583.
TreeFami TF330344.

Miscellaneous databases

ChiTaRSi SON. human.
GeneWikii SON.
GenomeRNAii 6651.
NextBioi 25923.
PROi P18583.
SOURCEi Search...

Gene expression databases

Bgeei P18583.
ExpressionAtlasi P18583. baseline and differential.
Genevestigatori P18583.

Family and domain databases

Gene3Di 3.30.160.20. 1 hit.
InterProi IPR014720. dsRNA-bd_dom.
IPR000467. G_patch_dom.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF01585. G-patch. 1 hit.
[Graphical view ]
SMARTi SM00443. G_patch. 1 hit.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS50137. DS_RBD. 1 hit.
PS50174. G_PATCH. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map."
    Reymond A., Friedli M., Neergaard Henrichsen C., Chapot F., Deutsch S., Ucla C., Rossier C., Lyle R., Guipponi M., Antonarakis S.E.
    Genomics 78:46-54(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E AND F), VARIANTS SER-473; SER-473 AND LEU-1202.
  2. "Transcription repression of human hepatitis B virus genes by negative regulatory element-binding protein/SON."
    Sun C.-T., Lo W.-Y., Wang I.-H., Lo Y.-H., Shiou S.-R., Lai C.-K., Ting L.-P.
    J. Biol. Chem. 276:24059-24067(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM G), VARIANTS SER-473 AND LEU-1202; CYS-1575.
    Tissue: Liver.
  3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), VARIANTS SER-473 AND LEU-1202; CYS-1575.
    Tissue: Brain.
  4. "The DNA sequence of human chromosome 21."
    Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A.
    , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
    Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-473.
  6. "mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs."
    Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M.
    Gene 321:185-193(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-689 (ISOFORM H).
    Tissue: Placenta.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130.
    Tissue: Smooth muscle.
  8. "Human partial CDS from CD34+ stem cells."
    Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-114, VARIANT CYS-1575.
    Tissue: Umbilical cord blood.
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 544-1903.
    Tissue: Brain.
  10. "Identification of a protein product of a novel human gene SON and the biological effect upon administering a changed form of this gene into mammalian cells."
    Chumakov I.M., Berdichevskii F.B., Sokolova N.V., Reznikov M.V., Prasolov V.S.
    Mol. Biol. (Mosk.) 25:731-740(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 554-2426 (ISOFORM A).
  11. "The human SON gene: the large and small transcripts contains various 5'-terminal sequences."
    Bliskovskii V.V., Kirillov A.V., Zakhariev V.M., Chumakov I.M.
    Mol. Biol. (Mosk.) 26:807-812(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-1079 (ISOFORM I).
    Tissue: Placenta.
  12. "Coding part of the son gene small transcript contains four areas of complete tandem repeats."
    Bliskovskii V.V., Berdichevskii F.B., Tkachenko A.V., Belova M.E., Chumakov I.M.
    Mol. Biol. (Mosk.) 26:793-806(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1009-2426 (ISOFORMS A/D), VARIANTS SER-473 AND LEU-1202.
    Tissue: Placenta.
  13. "A cDNA clone for a novel nuclear protein with DNA binding activity."
    Mattioni T., Hume C.R., Konigorski S., Hayes P., Osterweil Z., Lee J.S.
    Chromosoma 101:618-624(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1145-2426 (ISOFORM F), SUBCELLULAR LOCATION, VARIANTS SER-473 AND LEU-1202.
  14. "Decoding of the primary structure of the son3 region in human genome: identification of a new protein with unusual structure and homology with DNA-binding proteins."
    Berdichevskii F.B., Chumakov I.M., Kiselev L.L.
    Mol. Biol. (Mosk.) 22:794-801(1988) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1693-2175 (ISOFORM A).
  15. "A selection system for human apoptosis inhibitors using yeast."
    Greenhalf W., Lee J., Chaudhuri B.
    Yeast 15:1307-1321(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1939-2426 (ISOFORM J).
    Tissue: Cerebellum.
  16. Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
  17. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1697, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-1556; SER-1697; SER-1783; SER-1948 AND SER-1950, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  19. "Disruption of the NHR4 domain structure in AML1-ETO abrogates SON binding and promotes leukemogenesis."
    Ahn E.Y., Yan M., Malakhova O.A., Lo M.C., Boyapati A., Ommen H.B., Hines R., Hokland P., Zhang D.E.
    Proc. Natl. Acad. Sci. U.S.A. 105:17103-17108(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH AML1-MTG8 FUSION PROTEIN.
  20. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  21. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154; SER-283 AND SER-1556, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  22. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-16; LYS-288 AND LYS-2055, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  23. "SON is a spliceosome-associated factor required for mitotic progression."
    Huen M.S., Sy S.M., Leung K.M., Ching Y.P., Tipoe G.L., Man C., Dong S., Chen J.
    Cell Cycle 9:2679-2685(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH THE SPLICEOSOME.
  24. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94; SER-142; SER-152; SER-154; SER-283; SER-1697; SER-1769; SER-2009; SER-2011; SER-2013 AND THR-2163, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  25. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  26. "SON controls cell-cycle progression by coordinated regulation of RNA splicing."
    Ahn E.Y., Dekelver R.C., Lo M.C., Nguyen T.A., Matsuura S., Boyapati A., Pandit S., Fu X.D., Zhang D.E.
    Mol. Cell 42:185-198(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, RNA-BINDING, INTERACTION WITH SRSF2.
  27. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-154; SER-160; SER-283; SER-1556; SER-1697; SER-1769; SER-2011 AND SER-2013, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  28. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSON_HUMAN
AccessioniPrimary (citable) accession number: P18583
Secondary accession number(s): D3DSF5
, D3DSF6, E7ETE8, E7EU67, E7EVW3, E9PFQ2, O14487, O95981, Q14120, Q6PKE0, Q9H7B1, Q9P070, Q9P072, Q9UKP9, Q9UPY0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 151 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3