Reviewed,
UniProtKB/Swiss-Prot P18583 (SON_HUMAN)
Last modified
June 16, 2009.
Version 100.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: SON protein Alternative name(s): SON3 Negative regulatory element-binding protein Short name=NRE-binding protein DBP-5 Bax antagonist selected in saccharomyces 1 Short name=BASS1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2426 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Represses hepatitis B virus (HBV) core promoter activity and transcription of HBV genes and production of HBV virions. Binds to the consensus DNA sequence: 5'-GA[GT]AN[CG][AG]CC-3'. Might protect cells from apoptosis. Might be involved in pre-mRNA splicing By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed, with the higher expression seen in leukocyte and heart. |
| Domain | Contains 8 types of repeats which are distributed in 3 regions. |
| Miscellaneous | Colocalizes with the pre-mRNA splicing factor SFRS2/SC-35. |
| Sequence similarities | Contains 1 DRBM (double-stranded RNA-binding) domain. Contains 1 G-patch domain. |
| Sequence caution | The sequence CAA44793.1 differs from that shown. Reason: Frameshift at positions 2315, 2412 and 2417. The sequence CAA45282.1 differs from that shown. Reason: Frameshift at position 2412. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Ligand | DNA-binding RNA-binding |
| PTM | Acetylation Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | anti-apoptosis Ref.12 Inferred from direct assay. Source: UniProtKB |
| Cellular component | nuclear speck Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Traceable author statement. Source: ProtInc double-stranded RNA bindingInferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform F (identifier: P18583-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: P18583-2) The sequence of this isoform differs from the canonical sequence as follows: 687-687: V → Q 688-1006: Missing. 2410-2426: RNGALTRPNCMFFLNRY → INGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR | ||||||
| Isoform B (identifier: P18583-3) The sequence of this isoform differs from the canonical sequence as follows: 2220-2303: PVDISTAMSE...KKDQFLRAAP → GRVKRQGRVR...SRLYSSRFWW 2304-2426: Missing. | ||||||
| Isoform C (identifier: P18583-4) The sequence of this isoform differs from the canonical sequence as follows: 2296-2325: DQFLRAAPVTGGMGAVLMRKMGWREGEGLG → GQILVAVFLPRSVPAVLFTTLLLPRPRISS 2326-2426: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform D (identifier: P18583-5) The sequence of this isoform differs from the canonical sequence as follows: 2410-2426: RNGALTRPNCMFFLNRY → INGSAYQPSFASPNKKHAKATAATVVLQAMGLVPKDLMANATCFRSASRR | ||||||
| Isoform E (identifier: P18583-6) The sequence of this isoform differs from the canonical sequence as follows: 2108-2108: K → F 2109-2426: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform G (identifier: P18583-7) The sequence of this isoform differs from the canonical sequence as follows: 748-787: Missing. | ||||||
| Isoform H (identifier: P18583-8) The sequence of this isoform differs from the canonical sequence as follows: 687-689: VAQ → NVP 690-2416: Missing. | ||||||
| Isoform I (identifier: P18583-9) The sequence of this isoform differs from the canonical sequence as follows: 770-770: S → SMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSS | ||||||
| Isoform J (identifier: P18583-10) The sequence of this isoform differs from the canonical sequence as follows: 2257-2282: IDAWAQLNSIPGQFTGSTGVQVLTQE → VCSSFLKKIIIYHQPTHTNVPVLMSK 2283-2426: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2426 | 2426 | SON protein | PRO_0000072037 | |||||
Regions | |||||||||
| Repeat | 1006 – 1011 | 6 | 1-1 | ||||||
| Repeat | 1014 – 1019 | 6 | 1-2 | ||||||
| Repeat | 1021 – 1026 | 6 | 1-3 | ||||||
| Repeat | 1030 – 1035 | 6 | 1-4 | ||||||
| Repeat | 1038 – 1043 | 6 | 1-5 | ||||||
| Repeat | 1046 – 1051 | 6 | 1-6 | ||||||
| Repeat | 1055 – 1060 | 6 | 1-7 | ||||||
| Repeat | 1063 – 1068 | 6 | 1-8 | ||||||
| Repeat | 1071 – 1076 | 6 | 1-9 | ||||||
| Repeat | 1080 – 1085 | 6 | 1-10 | ||||||
| Repeat | 1089 – 1094 | 6 | 1-11 | ||||||
| Repeat | 1100 – 1105 | 6 | 1-12 | ||||||
| Repeat | 1111 – 1116 | 6 | 1-13 | ||||||
| Repeat | 1121 – 1126 | 6 | 1-14 | ||||||
| Repeat | 1925 – 1931 | 7 | 2-1 | ||||||
| Repeat | 1934 – 1952 | 19 | 3-1 | ||||||
| Repeat | 1953 – 1959 | 7 | 2-2 | ||||||
| Repeat | 1960 – 1966 | 7 | 2-3 | ||||||
| Repeat | 1967 – 1973 | 7 | 2-4 | ||||||
| Repeat | 1974 – 1980 | 7 | 2-5 | ||||||
| Repeat | 1981 – 1987 | 7 | 2-6 | ||||||
| Repeat | 1988 – 1994 | 7 | 2-7 | ||||||
| Repeat | 1995 – 2013 | 19 | 3-2 | ||||||
| Domain | 2305 – 2351 | 47 | G-patch | ||||||
| Domain | 2371 – 2426 | 56 | DRBM | ||||||
| Region | 726 – 895 | 170 | 17 X 10 AA tandem repeats of L-A-[ST]-[NSG]-[TS]-MDSQM | ||||||
| Region | 912 – 988 | 77 | 11 X 7 AA tandem repeats of [DR]-P-Y-R-[LI][AG][QHP] | ||||||
| Region | 1006 – 1126 | 121 | 14 X 6 AA repeats of [ED]-R-S-M-M-S | ||||||
| Region | 1147 – 1179 | 33 | 3 X 11 AA tandem repats of P-P-L-P-P-E-E-P-P-[TME]-[MTG] | ||||||
| Region | 1359 – 1390 | 32 | 4 X 8 AA tandem repeats of V-L-E-SS-[AVT]-VT | ||||||
| Region | 1925 – 1994 | 70 | 7 X 7 AA repeats of P-S-R-R-S-R-[TS] | ||||||
| Region | 1934 – 2013 | 80 | 2 X 19 AA repeats of P-S-R-R-R-R-S-R-S-V-V-R-R-R-S-F-S-I-S | ||||||
| Region | 2013 – 2039 | 27 | 3 X tandem repeats of [ST]-P-[VLI]-R-[RL]-[RK]-[RF]-S-R | ||||||
Amino acid modifications | |||||||||
| Modified residue | 94 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 152 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 154 | 1 | Phosphoserine Ref.18 | ||||||
| Modified residue | 283 | 1 | Phosphoserine Ref.15 Ref.18 Ref.14 Ref.17 | ||||||
| Modified residue | 348 | 1 | Phosphoserine Ref.20 | ||||||
| Modified residue | 910 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 1051 | 1 | Phosphoserine Ref.20 | ||||||
| Modified residue | 1556 | 1 | Phosphoserine Ref.21 Ref.20 | ||||||
| Modified residue | 1651 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 1688 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1697 | 1 | Phosphoserine Ref.15 Ref.21 Ref.18 Ref.14 Ref.20 | ||||||
| Modified residue | 1766 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 1769 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 1782 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 1783 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 1784 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1948 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 1950 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 1954 | 1 | Phosphoserine Ref.21 | ||||||
| Modified residue | 1961 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 2009 | 1 | Phosphoserine Ref.15 Ref.21 | ||||||
| Modified residue | 2011 | 1 | Phosphoserine Ref.15 Ref.21 | ||||||
| Modified residue | 2013 | 1 | Phosphoserine Ref.15 Ref.21 Ref.14 | ||||||
| Modified residue | 2029 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 2031 | 1 | Phosphoserine Ref.15 | ||||||
| Modified residue | 2055 | 1 | N6-acetyllysine Ref.16 | ||||||
| Modified residue | 2129 | 1 | Phosphoserine Ref.15 Ref.19 | ||||||
Natural variations | |||||||||
| Alternative sequence | 687 – 689 | 3 | VAQ → NVP in isoform H. | VSP_004411 | |||||
| Alternative sequence | 687 | 1 | V → Q in isoform A. | VSP_004401 | |||||
| Alternative sequence | 688 – 1006 | 319 | Missing in isoform A. | VSP_004402 | |||||
| Alternative sequence | 690 – 2416 | 1727 | Missing in isoform H. | VSP_004412 | |||||
| Alternative sequence | 748 – 787 | 40 | Missing in isoform G. | VSP_004410 | |||||
| Alternative sequence | 770 | 1 | S → SMDSQMLASNTMDSQMLASN TMDSQMLASSTMDSQMLATS S in isoform I. | VSP_004413 | |||||
| Alternative sequence | 2108 | 1 | K → F in isoform E. | VSP_004408 | |||||
| Alternative sequence | 2109 – 2426 | 318 | Missing in isoform E. | VSP_004409 | |||||
| Alternative sequence | 2220 – 2303 | 84 | PVDIS…LRAAP → GRVKRQGRVRRQMKQPAASH LTVTRCNSLCGTKPQSEKHR IAENSVITSLPNIGPSLHLW EGSPRYNYLASRFASRLYSS RFWW in isoform B. | VSP_004404 | |||||
| Alternative sequence | 2257 – 2282 | 26 | IDAWA…VLTQE → VCSSFLKKIIIYHQPTHTNV PVLMSK in isoform J. | VSP_004414 | |||||
| Alternative sequence | 2283 – 2426 | 144 | Missing in isoform J. | VSP_004415 | |||||
| Alternative sequence | 2296 – 2325 | 30 | DQFLR…GEGLG → GQILVAVFLPRSVPAVLFTT LLLPRPRISS in isoform C. | VSP_004406 | |||||
| Alternative sequence | 2304 – 2426 | 123 | Missing in isoform B. | VSP_004405 | |||||
| Alternative sequence | 2326 – 2426 | 101 | Missing in isoform C. | VSP_004407 | |||||
| Alternative sequence | 2410 – 2426 | 17 | RNGAL…FLNRY → INGSAYQPSFASPNKKHAKA TAATVVLQAMGLVPKDLMAN ATCFRSASRR in isoform A and isoform D. | VSP_004403 | |||||
| Natural variant | 870 | 1 | T → A: dbSNP rs11908823. | VAR_056990 | |||||
| Natural variant | 1575 | 1 | R → C: dbSNP rs13047599. | VAR_056991 | |||||
Experimental info | |||||||||
| Sequence conflict | 126 | 1 | E → K Ref.4 | ||||||
| Sequence conflict | 129 | 1 | Y → K Ref.4 | ||||||
| Sequence conflict | 473 | 1 | S → P Ref.2 | ||||||
| Sequence conflict | 473 | 1 | S → P Ref.6 | ||||||
| Sequence conflict | 1402 | 1 | Y → S Ref.7 | ||||||
| Sequence conflict | 1495 | 1 | N → I Ref.7 | ||||||
| Sequence conflict | 1538 | 1 | N → S Ref.7 | ||||||
| Sequence conflict | 1643 | 1 | I → II Ref.7 | ||||||
| Sequence conflict | 1692 | 1 | L → I Ref.7 | ||||||
| Sequence conflict | 1692 | 1 | L → R Ref.11 | ||||||
| Sequence conflict | 1693 | 1 | A → R Ref.11 | ||||||
| Sequence conflict | 1820 – 1821 | 2 | SS → PH Ref.7 | ||||||
| Sequence conflict | 1820 – 1821 | 2 | SS → PH Ref.11 | ||||||
| Sequence conflict | 1939 | 1 | R → S Ref.12 | ||||||
| Sequence conflict | 2090 | 1 | E → V Ref.2 | ||||||
| Sequence conflict | 2090 | 1 | E → V Ref.7 | ||||||
| Sequence conflict | 2148 | 1 | P → F Ref.2 | ||||||
| Sequence conflict | 2148 | 1 | P → F Ref.7 | ||||||
| Sequence conflict | 2413 – 2416 | 4 | ALTR → SPYQ Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map." Reymond A., Friedli M., Neergaard Henrichsen C., Chapot F., Deutsch S., Ucla C., Rossier C., Lyle R., Guipponi M., Antonarakis S.E. Genomics 78:46-54(2001) [PubMed: 11707072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E AND F). |
| [2] | "Transcription repression of human hepatitis B virus genes by negative regulatory element-binding protein/SON." Sun C.-T., Lo W.-Y., Wang I.-H., Lo Y.-H., Shiou S.-R., Lai C.-K., Ting L.-P. J. Biol. Chem. 276:24059-24067(2001) [PubMed: 11306577] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM G), VARIANT CYS-1575. Tissue: Liver. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed: 10470851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Brain. |
| [4] | "mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs." Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M. Gene 321:185-193(2003) [PubMed: 14637006] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-689 (ISOFORM H). Tissue: Placenta. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-130. Tissue: Smooth muscle. |
| [6] | "Human partial CDS from CD34+ stem cells." Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-114, VARIANT CYS-1575. Tissue: Umbilical cord blood. |
| [7] | "Identification of a protein product of a novel human gene SON and the biological effect upon administering a changed form of this gene into mammalian cells." Chumakov I.M., Berdichevskii F.B., Sokolova N.V., Reznikov M.V., Prasolov V.S. Mol. Biol. (Mosk.) 25:731-740(1991) [PubMed: 1944255] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 554-2426 (ISOFORM A). |
| [8] | "The human SON gene: the large and small transcripts contains various 5'-terminal sequences." Bliskovskii V.V., Kirillov A.V., Zakhariev V.M., Chumakov I.M. Mol. Biol. (Mosk.) 26:807-812(1992) [PubMed: 1435774] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-1079 (ISOFORM I). Tissue: Placenta. |
| [9] | "Coding part of the son gene small transcript contains four areas of complete tandem repeats." Bliskovskii V.V., Berdichevskii F.B., Tkachenko A.V., Belova M.E., Chumakov I.M. Mol. Biol. (Mosk.) 26:793-806(1992) [PubMed: 1435773] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1009-1131. Tissue: Placenta. |
| [10] | "A cDNA clone for a novel nuclear protein with DNA binding activity." Mattioni T., Hume C.R., Konigorski S., Hayes P., Osterweil Z., Lee J.S. Chromosoma 101:618-624(1992) [PubMed: 1424986] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1145-2426 (ISOFORM F). |
| [11] | "Decoding of the primary structure of the son3 region in human genome: identification of a new protein with unusual structure and homology with DNA-binding proteins." Berdichevskii F.B., Chumakov I.M., Kiselev L.L. Mol. Biol. (Mosk.) 22:794-801(1988) [PubMed: 3054499] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1692-2175 (ISOFORM A). |
| [12] | "A selection system for human apoptosis inhibitors using yeast." Greenhalf W., Lee J., Chaudhuri B. Yeast 15:1307-1321(1999) [PubMed: 10509013] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1939-2426 (ISOFORM J). Tissue: Cerebellum. |
| [13] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [14] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283; SER-910; SER-1651; SER-1697; SER-1766; SER-1769 AND SER-2013, MASS SPECTROMETRY. Tissue: Epithelium. |
| [15] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94; SER-283; SER-1697; SER-2009; SER-2011; SER-2013; SER-2029; SER-2031 AND SER-2129, MASS SPECTROMETRY. Tissue: Epithelium. |
| [16] | "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T., Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y. Mol. Cell 23:607-618(2006) [PubMed: 16916647] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-2055, MASS SPECTROMETRY. Tissue: Epithelium. |
| [17] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-283, MASS SPECTROMETRY. Tissue: Epithelium. |
| [18] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-154; SER-283 AND SER-1697, MASS SPECTROMETRY. Tissue: Epithelium. |
| [19] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2129, MASS SPECTROMETRY. |
| [20] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-348; SER-1051; SER-1556 AND SER-1697, MASS SPECTROMETRY. |
| [21] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-1556; SER-1697; SER-1782; SER-1783; SER-1948; SER-1950; SER-1954; SER-2009; SER-2011 AND SER-2013, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF380179 mRNA. Translation: AAL34497.1. AF380180 mRNA. Translation: AAL34498.1. AF380181 mRNA. Translation: AAL34499.1. AF380182 mRNA. Translation: AAL34500.1. AF380183 mRNA. Translation: AAL34501.1. AF380184 mRNA. Translation: AAL34502.1. AY026895 mRNA. Translation: AAK07692.1. AB028942 mRNA. Translation: BAA82971.2. Different initiation. AF435977 mRNA. Translation: AAL30810.1. AK024752 mRNA. Translation: BAB14985.1. AF161428 mRNA. Translation: AAF28988.1. AF161430 mRNA. Translation: AAF28990.1. X63751 mRNA. Translation: CAC69885.1. X63753 mRNA. Translation: CAA45282.1. Frameshift. X63071 mRNA. Translation: CAA44793.1. Frameshift. M36428 Genomic DNA. Translation: AAA36624.1. AF139897 mRNA. Translation: AAD50078.1. | |
| IPI | IPI00000192. IPI00217930. IPI00218617. IPI00218618. IPI00218619. IPI00218620. IPI00218621. IPI00218622. IPI00218624. IPI00748258. |
| PIR | S26650. |
| RefSeq | NP_115571.1. NP_620305.1. |
| UniGene | Hs.517262 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P18583. 1 interaction. |
PTM databases | |
| PhosphoSite | P18583. |
Proteomic databases | |
| PRIDE | P18583. |
Genome annotation databases | |
| Ensembl | ENSG00000159140. Homo sapiens. [Contig view] |
| GeneID | 6651. |
| KEGG | hsa:6651. |
Organism-specific databases | |
| GeneCards | GC21P033837. |
| HGNC | HGNC:11183. SON. |
| MIM | 182465. gene. |
| PharmGKB | PA27459. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P18583. |
Gene expression databases | |
| ArrayExpress | P18583. |
| Bgee | P18583. |
| GermOnline | ENSG00000159140. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001159. Ds-RNA_bd. IPR014720. dsRNA-bd-like. IPR000467. G_patch. [Graphical view] |
| Gene3D | G3DSA:3.30.160.20. dsRNA-bd-like. 1 hit. |
| Pfam | PF00035. dsrm. 1 hit. PF01585. G-patch. 1 hit. [Graphical view] |
| ProDom | PD153432. Csurface_antigen. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00443. G_patch. 1 hit. [Graphical view] |
| PROSITE | PS50137. DS_RBD. 1 hit. PS50174. G_PATCH. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 25923. |
| SOURCE | Search... |
Entry information
| Entry name | SON_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P18583 Secondary accession number(s): O14487 Q9UPY0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


