Reviewed,
UniProtKB/Swiss-Prot P18577 (RHCE_HUMAN)
Last modified
March 2, 2010.
Version 100.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Blood group Rh(CE) polypeptide Alternative name(s): Rhesus C/E antigens Rh30A RhIXB Rh polypeptide 1 Short name=RhPI CD_antigen=CD240CE | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 417 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. |
| Subcellular location | |
| Tissue specificity | Restricted to tissues or cell lines expressing erythroid characters. Isoform 4g and isoform RhPI-Alpha are expressed in immature erythroblasts but not in mature erythroblasts. Ref.20 |
| Polymorphism | RhCE and RhD are responsible for the RH blood group system. The molecular basis of the E=Rh3/e=Rh5 blood group antigens is a single variation in position 226; Pro-226 corresponds to Rh3 and Ala-226 to Rh5. The molecular basis of the C=Rh2/c=Rh4 blood group antigens is a single variation in position 102; Ser-103 corresponds to Rh2 and Pro-103 to Rh4. |
| Sequence similarities | Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane |
| Molecular function | Blood group antigen |
| Technical term | Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | transmembrane transport Inferred from electronic annotation. Source: InterPro |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | ammonium transmembrane transporter activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 14 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform RHI (identifier: P18577-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform RHIV (identifier: P18577-2) Also known as: 1e; The sequence of this isoform differs from the canonical sequence as follows: 314-354: VCCNRVLGIH...VLLVLHTVWN → DWLPGPPQHW...SQNMESTSCG 355-417: Missing. | ||||||
| Isoform RHVI (identifier: P18577-3) Also known as: 7c; The sequence of this isoform differs from the canonical sequence as follows: 164-268: Missing. 359-417: IGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF → FAPKSQNMESTSCG | ||||||
| Isoform RHVIII (identifier: P18577-4) The sequence of this isoform differs from the canonical sequence as follows: 163-313: Missing. | ||||||
| Isoform 1c (identifier: P18577-5) The sequence of this isoform differs from the canonical sequence as follows: 359-417: IGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF → FAPKSQNMESTSCG | ||||||
| Isoform 1d (identifier: P18577-6) The sequence of this isoform differs from the canonical sequence as follows: 358-417: MIGFQVLLSI...WKFPHLAVGF → IFLIWLLDFK...LLPAVREKRS | ||||||
| Isoform 1h (identifier: P18577-7) The sequence of this isoform differs from the canonical sequence as follows: 314-409: Missing. | ||||||
| Isoform 2e (identifier: P18577-8) The sequence of this isoform differs from the canonical sequence as follows: 268-308: TYVHSAVLAG...LVAGLISIGG → DWLPGPPQHW...SQNMESTSCG 309-417: Missing. | ||||||
| Isoform 4g (identifier: P18577-9) Also known as: RhPI-Beta; The sequence of this isoform differs from the canonical sequence as follows: 212-384: Missing. | ||||||
| Isoform 7a (identifier: P18577-10) The sequence of this isoform differs from the canonical sequence as follows: 164-268: Missing. | ||||||
| Isoform 8a (identifier: P18577-11) The sequence of this isoform differs from the canonical sequence as follows: 163-220: Missing. 301-313: Missing. | ||||||
| Isoform 8e (identifier: P18577-12) The sequence of this isoform differs from the canonical sequence as follows: 163-203: TDYHMNLRHF...GTEDNDQRAT → DWLPGPPQHW...SQNMESTSCG 204-417: Missing. | ||||||
| Isoform 8h (identifier: P18577-13) The sequence of this isoform differs from the canonical sequence as follows: 163-409: Missing. | ||||||
| Isoform RhPI-Alpha (identifier: P18577-14) The sequence of this isoform differs from the canonical sequence as follows: 227-242: LLRSPIQRKNAMFNTY → DRFAPKSQNMESTSCG 243-417: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.17 Ref.18 | ||||||
| Chain | 2 – 417 | 416 | Blood group Rh(CE) polypeptide | PRO_0000168189 | |||||
Regions | |||||||||
| Transmembrane | 12 – 32 | 21 | Potential | ||||||
| Transmembrane | 44 – 64 | 21 | Potential | ||||||
| Transmembrane | 77 – 97 | 21 | Potential | ||||||
| Transmembrane | 125 – 145 | 21 | Potential | ||||||
| Transmembrane | 172 – 192 | 21 | Potential | ||||||
| Transmembrane | 203 – 223 | 21 | Potential | ||||||
| Transmembrane | 238 – 258 | 21 | Potential | ||||||
| Transmembrane | 265 – 285 | 21 | Potential | ||||||
| Transmembrane | 287 – 307 | 21 | Potential | ||||||
| Transmembrane | 331 – 351 | 21 | Potential | ||||||
| Transmembrane | 358 – 378 | 21 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 163 – 409 | 247 | Missing in isoform 8h. | VSP_037505 | |||||
| Alternative sequence | 163 – 313 | 151 | Missing in isoform RHVIII. | VSP_005701 | |||||
| Alternative sequence | 163 – 220 | 58 | Missing in isoform 8a. | VSP_037506 | |||||
| Alternative sequence | 163 – 203 | 41 | TDYHM…DQRAT → DWLPGPPQHWGTQLGHRDSS HVWSPDRFAPKSQNMESTSC G in isoform 8e. | VSP_037507 | |||||
| Alternative sequence | 164 – 268 | 105 | Missing in isoform RHVI and isoform 7a. | VSP_005702 | |||||
| Alternative sequence | 204 – 417 | 214 | Missing in isoform 8e. | VSP_037508 | |||||
| Alternative sequence | 212 – 384 | 173 | Missing in isoform 4g. | VSP_037509 | |||||
| Alternative sequence | 227 – 242 | 16 | LLRSP…MFNTY → DRFAPKSQNMESTSCG in isoform RhPI-Alpha. | VSP_038405 | |||||
| Alternative sequence | 243 – 417 | 175 | Missing in isoform RhPI-Alpha. | VSP_038406 | |||||
| Alternative sequence | 268 – 308 | 41 | TYVHS…ISIGG → DWLPGPPQHWGTQLGHRDSS HVWSPDRFAPKSQNMESTSC G in isoform 2e. | VSP_037510 | |||||
| Alternative sequence | 301 – 313 | 13 | Missing in isoform 8a. | VSP_037511 | |||||
| Alternative sequence | 309 – 417 | 109 | Missing in isoform 2e. | VSP_037512 | |||||
| Alternative sequence | 314 – 409 | 96 | Missing in isoform 1h. | VSP_037513 | |||||
| Alternative sequence | 314 – 354 | 41 | VCCNR…HTVWN → DWLPGPPQHWGTQLGHRDSS HVWSPDRFAPKSQNMESTSC G in isoform RHIV. | VSP_005703 | |||||
| Alternative sequence | 355 – 417 | 63 | Missing in isoform RHIV. | VSP_005704 | |||||
| Alternative sequence | 358 – 417 | 60 | MIGFQ…LAVGF → IFLIWLLDFKQKHPRKTRPV QKQDNFLSLLPAVREKRS in isoform 1d. | VSP_037514 | |||||
| Alternative sequence | 359 – 417 | 59 | IGFQV…LAVGF → FAPKSQNMESTSCG in isoform RHVI and isoform 1c. | VSP_005705 | |||||
| Natural variant | 16 | 1 | W → C Associated with altered expression of E antigen. Ref.5 Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.13 Ref.14 Ref.15 Ref.22 | VAR_006911 | |||||
| Natural variant | 36 | 1 | A → T in C(X)/Rh9 antigen. | VAR_006912 | |||||
| Natural variant | 41 | 1 | Q → R in C(W)/Rh8 antigen. | VAR_006913 | |||||
| Natural variant | 60 | 1 | L → I | VAR_006914 | |||||
| Natural variant | 68 | 1 | N → S: dbSNP rs1053344. Ref.8 Ref.10 Ref.12 Ref.13 Ref.15 Ref.6 | VAR_006915 | |||||
| Natural variant | 103 | 1 | P → S in C/Rh2 antigen. dbSNP rs676785. Ref.8 Ref.10 Ref.12 Ref.13 Ref.15 Ref.6 | VAR_006916 | |||||
| Natural variant | 127 | 1 | A → V: dbSNP rs1053346. Ref.6 | VAR_055260 | |||||
| Natural variant | 128 | 1 | G → D: dbSNP rs1053347. Ref.6 | VAR_055261 | |||||
| Natural variant | 154 | 1 | R → T in RhEKH. Ref.6 | VAR_013301 | |||||
| Natural variant | 182 | 1 | T → S: dbSNP rs1053350. | VAR_055262 | |||||
| Natural variant | 198 | 1 | N → K: dbSNP rs1053354. | VAR_055263 | |||||
| Natural variant | 226 | 1 | P → A in E/Rh5 antigen. dbSNP rs609320. Ref.5 Ref.7 Ref.8 Ref.9 Ref.12 Ref.13 Ref.14 Ref.15 Ref.22 Ref.11 | VAR_006917 | |||||
| Natural variant | 233 | 1 | Q → E in RhEFM. Ref.9 Ref.6 | VAR_013302 | |||||
| Natural variant | 238 | 1 | M → V in RhEFM. Ref.7 Ref.6 | VAR_013303 | |||||
| Natural variant | 245 | 1 | L → V in VS antigen. dbSNP rs1053361. Ref.7 Ref.9 | VAR_006918 | |||||
| Natural variant | 263 | 1 | R → G: dbSNP rs1132763. Ref.7 | VAR_057987 | |||||
| Natural variant | 267 | 1 | M → K: dbSNP rs1132764. Ref.7 Ref.13 | VAR_057988 | |||||
| Natural variant | 323 | 1 | H → P: dbSNP rs1053366. | VAR_055264 | |||||
| Natural variant | 325 | 1 | I → S: dbSNP rs1053367. | VAR_055265 | |||||
| Natural variant | 329 | 1 | H → D: dbSNP rs1053370. | VAR_055266 | |||||
| Natural variant | 329 | 1 | H → R: dbSNP rs1053371. | VAR_055267 | |||||
| Natural variant | 330 | 1 | S → Y: dbSNP rs1053372. | VAR_055268 | |||||
| Natural variant | 331 | 1 | I → N: dbSNP rs1053373. | VAR_055269 | |||||
| Natural variant | 398 | 1 | V → E: dbSNP rs630612. Ref.12 | VAR_057989 | |||||
Experimental info | |||||||||
| Sequence conflict | 10 | 1 | R → W in ACK75562. Ref.13 | ||||||
| Sequence conflict | 12 | 1 | C → L AA sequence Ref.18 | ||||||
| Sequence conflict | 53 | 1 | D → G in CAA44812. Ref.3 | ||||||
| Sequence conflict | 61 | 1 | G → C in CAA44812. Ref.3 | ||||||
| Sequence conflict | 114 | 1 | R → W in AAN75123. Ref.7 | ||||||
| Sequence conflict | 115 | 1 | L → P in ACK75563. Ref.13 | ||||||
| Sequence conflict | 115 | 1 | L → P in ACK75565. Ref.13 | ||||||
| Sequence conflict | 121 | 1 | M → L in BAB16597. Ref.6 | ||||||
| Sequence conflict | 121 | 1 | M → L in BAA82627. Ref.6 | ||||||
| Sequence conflict | 122 | 1 | S → P in ACK75564. Ref.13 | ||||||
| Sequence conflict | 125 | 1 | I → N in ACK75565. Ref.13 | ||||||
| Sequence conflict | 152 | 1 | T → N in BAB16597. Ref.6 | ||||||
| Sequence conflict | 152 | 1 | T → N in BAA82627. Ref.6 | ||||||
| Sequence conflict | 155 | 1 | M → V in AAT35811. Ref.8 | ||||||
| Sequence conflict | 166 | 1 | H → L in ACK75566. Ref.13 | ||||||
| Sequence conflict | 169 | 1 | L → Q in ACK75567. Ref.13 | ||||||
| Sequence conflict | 201 | 1 | R → T in ACK75568. Ref.13 | ||||||
| Sequence conflict | 217 | 1 | W → R in ACK75569. Ref.13 | ||||||
| Sequence conflict | 241 | 1 | T → I in ACK75570. Ref.13 | ||||||
| Sequence conflict | 250 | 1 | V → M in AAN75124. Ref.7 | ||||||
| Sequence conflict | 273 | 1 | A → V in AAN75122. Ref.7 | ||||||
| Sequence conflict | 303 | 1 | L → Q in ACK75572. Ref.13 | ||||||
| Sequence conflict | 378 | 1 | L → V in AAN75122. Ref.7 | ||||||
| Sequence conflict | 408 – 409 | 2 | WK → DI AA sequence Ref.21 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of a 30 kDa erythrocyte membrane protein associated with Rh (Rhesus)-blood-group-antigen expression." Avent N.D., Ridgwell K., Tanner M.J.A., Anstee D.J. Biochem. J. 271:821-825(1990) [PubMed: 2123099] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI). Tissue: Bone marrow. |
| [2] | "Molecular cloning and protein structure of a human blood group Rh polypeptide." Cherif-Zahar B., Bloy C., le van Kim C., Blanchard D., Bailly P., Hermand P., Salmon C., Cartron J.-P., Colin Y. Proc. Natl. Acad. Sci. U.S.A. 87:6243-6247(1990) [PubMed: 1696722] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), PARTIAL PROTEIN SEQUENCE. Tissue: Bone marrow. |
| [3] | "Multiple Rh messenger RNA isoforms are produced by alternative splicing." le van Kim C., Cherif-Zahar B., Raynal V., Mouro I., Lopez M., Cartron J.-P., Colin Y. Blood 80:1074-1078(1992) [PubMed: 1379850] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS RHIV; RHVI AND RHVIII). Tissue: Bone marrow. |
| [4] | "Isolation of a new cDNA clone encoding an Rh polypeptide associated with the Rh blood group system." Kajii E., Umenishi F., Iwamoto S., Ikemoto S. Hum. Genet. 91:157-162(1993) [PubMed: 7916743] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI). |
| [5] | "16Cys encoded by the RHce gene is associated with altered expression of the e antigen and is frequent in the R0 haplotype." Westhoff C.M., Silberstein L.E., Wylie D.E., Skavdahl M., Reid M.E. Br. J. Haematol. 113:666-671(2001) [PubMed: 11380456] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANT CYS-16, VARIANT E/RH5 ANTIGEN ALA-226. |
| [6] | "E variants found in Japanese and c antigenicity alteration without substitution in the second extracellular loop." Kashiwase K., Ishikawa Y., Hyodo H., Watanabe Y., Ogawa A., Tsuneyama H., Toyoda C., Uchikawa M., Akaza T., Omine M., Juji T. Transfusion 41:1408-1412(2001) [PubMed: 11724987] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANTS ILE-60; SER-68; SER-103; VAL-127; ASP-128; RHEKH THR-154; RHEFM GLU-233 AND RHEFM VAL-238. |
| [7] | "Rare RHCE phenotypes in black individuals of Afro-Caribbean origin: identification and transfusion safety." Noizat-Pirenne F., Lee K., Le Pennec P.-Y., Simon P., Kazup P., Bachir D., Rouzaud A.M., Roussel M., Juszczak G., Menanteau C., Rouger P., Kotb R., Cartron J.-P., Ansart-Pirenne H. Blood 100:4223-4231(2002) [PubMed: 12393640] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANTS CYS-16; ALA-226; VAL-238; VAL-245; GLY-263 AND LYS-267. |
| [8] | "A new RhCe allele in Chinese Han population." Yan L., Xu X., Zhu F. Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANTS CYS-16; ILE-60; SER-68; SER-103 AND ALA-226. |
| [9] | "Molecular basis for Crawford antigen expression." Westhoff C.M., Vege S. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANTS CYS-16; ALA-226; GLU-233 AND VAL-245. |
| [10] | "RHCE gene, allele CE, antigen CE." Vege S., Westhoff C.M. Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANTS CYS-16; ILE-60; SER-68 AND SER-103. |
| [11] | "RHCE gene, allele RHce, ce antigen." Westhoff C.M., Vege S. Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM RHI), VARIANT ALA-226. |
| [12] | "RHD allele and RH haplotype distribution in Tibetans." Wei Q., Flegel W.A. Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-16; ILE-60; SER-68; SER-103; ALA-226 AND GLU-398. |
| [13] | Bugert P., Scharberg E.A., Geisen C., von Zabern I., Flegel W.A. Submitted (NOV-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CYS-16; ILE-60; SER-68; SER-103; ALA-226 AND LYS-267. |
| [14] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS CYS-16 AND ALA-226. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM RHI), VARIANTS CYS-16; ILE-60; SER-68; SER-103 AND ALA-226. Tissue: Brain. |
| [16] | "Organization of the gene (RHCE) encoding the human blood group RhCcEe antigens and characterization of the promoter region." Cherif-Zahar B., le van Kim C., Rouillac C., Raynal V., Cartron J.-P., Colin Y. Genomics 19:68-74(1994) [PubMed: 8188244] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-11. |
| [17] | "Protein-sequence studies on Rh-related polypeptides suggest the presence of at least two groups of proteins which associate in the human red-cell membrane." Avent N.D., Ridgwell K., Mawby W.J., Tanner M.J.A., Anstee D.J., Kumpel B. Biochem. J. 256:1043-1046(1988) [PubMed: 3146980] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-33. |
| [18] | "Determination of the N-terminal sequence of human red cell Rh(D) polypeptide and demonstration that the Rh(D), (c), and (E) antigens are carried by distinct polypeptide chains." Bloy C., Blanchard D., Dahr W., Beyreuther K., Salmon C., Cartron J.-P. Blood 72:661-666(1988) [PubMed: 3135863] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-17. |
| [19] | "Intricate combinatorial patterns of exon splicing generate multiple Rh-related isoforms in human erythroid cells." Kajii E., Umenishi F., Omi T., Ikemoto S. Hum. Genet. 95:657-665(1995) [PubMed: 7789951] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 141-417 (ISOFORMS 1C; 1D; 1H; 2E; 4G; 7A; 8A; 8E; 8H; RHIV AND RHVI), ALTERNATIVE SPLICING. Tissue: Blood. |
| [20] | "Identification of two Rh mRNA isoforms expressed in immature erythroblasts." Umenishi F., Kajii E., Ikemoto S. Biochem. Biophys. Res. Commun. 198:1135-1142(1994) [PubMed: 8117271] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 201-417 (ISOFORMS 4G AND RHPI-ALPHA), TISSUE SPECIFICITY. Tissue: Erythroblast. |
| [21] | "Regarding the size of Rh proteins." Suyama K., Goldstein J., Aebersold R., Kent S. Blood 77:411-411(1991) [PubMed: 1898705] [Abstract] Cited for: PROTEIN SEQUENCE OF 402-409. |
| [22] | "RHCE represents the ancestral RH position, while RHD is the duplicated gene." Wagner F.F., Flegel W.A. Blood 99:2272-2273(2002) [PubMed: 11902138] [Abstract] Cited for: IDENTIFICATION, VARIANTS CYS-16 AND ALA-226. |
| [23] | "Molecular genetic basis of the human Rhesus blood group system." Mouro I., Colin Y., Cherif-Zahar B., Cartron J.-P., le van Kim C. Nat. Genet. 5:62-65(1993) [PubMed: 8220426] [Abstract] Cited for: VARIANTS BLOOD GROUP C AND E. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X54534 mRNA. Translation: CAA38401.1. M34015 mRNA. Translation: AAA36567.1. X63095 mRNA. Translation: CAA44809.1. X63096 mRNA. Translation: CAA44810.1. X63098 mRNA. Translation: CAA44812.1. S57967 mRNA. Translation: AAB26080.1. DQ266400 mRNA. Translation: ABB69097.1. AB018644 mRNA. Translation: BAA33927.1. AB018645 mRNA. Translation: BAA33928.1. AB030388 mRNA. Translation: BAA82627.1. AB049753 mRNA. Translation: BAB16597.1. AF510065 mRNA. Translation: AAN75121.1. AF510066 mRNA. Translation: AAN75122.1. AF510067 mRNA. Translation: AAN75123.1. AF510068 mRNA. Translation: AAN75124.1. AY603478 mRNA. Translation: AAT35811.1. DQ178642 mRNA. Translation: ABA25912.1. DQ266353 mRNA. Translation: ABB97471.1. DQ322275 mRNA. Translation: ABC55358.1. AM398146 Genomic DNA. Translation: CAL44958.1. FJ486155 Genomic DNA. Translation: ACK75562.1. FJ486156 Genomic DNA. Translation: ACK75563.1. FJ486157 Genomic DNA. Translation: ACK75564.1. FJ486158 Genomic DNA. Translation: ACK75565.1. FJ486159 Genomic DNA. Translation: ACK75566.1. FJ486160 Genomic DNA. Translation: ACK75567.1. FJ486161 Genomic DNA. Translation: ACK75568.1. FJ486162 Genomic DNA. Translation: ACK75569.1. FJ486163 Genomic DNA. Translation: ACK75570.1. FJ486164 Genomic DNA. Translation: ACK75571.1. FJ486165 Genomic DNA. Translation: ACK75572.1. AL031284, AL928711 Genomic DNA. Translation: CAM12858.1. AL928711, AL031284 Genomic DNA. Translation: CAH72605.1. BC075081 mRNA. Translation: AAH75081.1. BC139905 mRNA. Translation: AAI39906.1. S70456 Genomic DNA. Translation: AAD14061.1. BN000065 Genomic DNA. Translation: CAD29850.1. |
| IPI | IPI00221016. IPI00465155. IPI00719561. IPI00827862. IPI00879775. IPI00930054. IPI00930155. IPI00930250. IPI00930255. IPI00930293. IPI00930477. IPI00930574. IPI00930628. IPI00953959. |
| PIR | A30405. I54193. PC2032. PC2033. S78478. S78479. S78480. |
| RefSeq | NP_065231.2. NP_619522.2. NP_619523.2. NP_619524.2. |
| UniGene | Hs.449968 Hs.647623 |
3D structure databases | |
| SMR | P18577. Positions 40-416. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P18577. |
Protein family/group databases | |
| TCDB | 1.A.11.4.3. ammonia transporter channel (Amt) family. |
Genome annotation databases | |
| Ensembl | ENST00000294413; ENSP00000294413; ENSG00000188672; Homo sapiens. [Genome view] |
| GeneID | 6006. |
| KEGG | hsa:6006. |
| UCSC | uc001bki.1. human. |
Organism-specific databases | |
| CTD | 6006. |
| GeneCards | GC01M025561. |
| H-InvDB | HIX0023511. |
| HGNC | HGNC:10008. RHCE. |
| MIM | 111690. phenotype. 111700. gene+phenotype. |
| Orphanet | 71275. Rh deficiency syndrome. |
| PharmGKB | PA34386. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG004374. |
| InParanoid | P18577. |
Gene expression databases | |
| ArrayExpress | P18577. |
| Bgee | P18577. |
| CleanEx | HS_RHCE. |
| Genevestigator | P18577. |
| GermOnline | ENSG00000188672. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001905. Ammonium_transpt. IPR002229. RhesusRHD. [Graphical view] |
| Pfam | PF00909. Ammonium_transp. 1 hit. [Graphical view] |
| PRINTS | PR00342. RHESUSRHD. |
| SUPFAM | SSF111352. RH_like_transpt. 1 hit. |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 23427. |
| SOURCE | Search... |
Entry information
| Entry name | RHCE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P18577 Secondary accession number(s): A7DW68 Q9UPN0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Blood group antigen proteins Nomenclature of blood group antigens and list of entries |
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


