Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P18091

- ACTN_DROME

UniProt

P18091 - ACTN_DROME

Protein

Alpha-actinin, sarcomeric

Gene

Actn

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 149 (01 Oct 2014)
      Sequence version 2 (21 Feb 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.2 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi791 – 802121PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi832 – 843122PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. actin binding Source: UniProtKB
    2. calcium ion binding Source: InterPro

    GO - Biological processi

    1. actin crosslink formation Source: InterPro
    2. actin cytoskeleton reorganization Source: FlyBase
    3. actin filament bundle assembly Source: InterPro
    4. cytoskeletal anchoring at plasma membrane Source: FlyBase
    5. flight behavior Source: FlyBase
    6. sarcomere organization Source: FlyBase

    Keywords - Ligandi

    Actin-binding, Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_184300. Syndecan interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-actinin, sarcomeric
    Alternative name(s):
    F-actin cross-linking protein
    Gene namesi
    Name:Actn
    Synonyms:fliA, l(1)2Cb
    ORF Names:CG4376
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome X

    Organism-specific databases

    FlyBaseiFBgn0000667. Actn.

    Subcellular locationi

    CytoplasmmyofibrilsarcomereZ line 1 Publication
    Note: Colocalizes with Smn at the Z-line of indirect flight muscles.

    GO - Cellular componenti

    1. focal adhesion Source: FlyBase
    2. Z disc Source: FlyBase

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 924924Alpha-actinin, sarcomericPRO_0000073447Add
    BLAST

    Proteomic databases

    PaxDbiP18091.
    PRIDEiP18091.

    Expressioni

    Tissue specificityi

    Larval muscle isoform is expressed in the larval body wall, adult muscles of the head and abdomen and supercontractile muscles of the larva and adult. Adult muscle isoform accumulates within adult fibrillar and tubular muscles.2 Publications

    Developmental stagei

    Larval muscle isoform is found in the larvae and adults, the adult muscle isoform in adults only.1 Publication

    Gene expression databases

    BgeeiP18091.

    Interactioni

    Subunit structurei

    Homodimer; antiparallel. Interacts with Smn; the interaction occurs in adult thoracic tissues.1 Publication

    Protein-protein interaction databases

    BioGridi57710. 35 interactions.
    DIPiDIP-22313N.

    Structurei

    3D structure databases

    ProteinModelPortaliP18091.
    SMRiP18091. Positions 31-255, 300-924.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 250250Actin-bindingAdd
    BLAST
    Domaini34 – 138105CH 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini147 – 250104CH 2PROSITE-ProRule annotationAdd
    BLAST
    Repeati251 – 395145Spectrin 1Add
    BLAST
    Repeati396 – 510115Spectrin 2Add
    BLAST
    Repeati511 – 631121Spectrin 3Add
    BLAST
    Repeati632 – 744113Spectrin 4Add
    BLAST
    Domaini778 – 81336EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini819 – 85436EF-hand 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the alpha-actinin family.Curated
    Contains 1 actin-binding domain.Curated
    Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation
    Contains 2 EF-hand domains.PROSITE-ProRule annotation
    Contains 4 spectrin repeats.Curated

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiCOG5069.
    InParanoidiP18091.
    KOiK05699.
    OMAiWIRRTMP.
    OrthoDBiEOG72C4ZJ.
    PhylomeDBiP18091.

    Family and domain databases

    Gene3Di1.10.238.10. 2 hits.
    1.10.418.10. 2 hits.
    InterProiIPR001589. Actinin_actin-bd_CS.
    IPR026921. Alpha-actinin_1.
    IPR001715. CH-domain.
    IPR011992. EF-hand-dom_pair.
    IPR014837. EF-hand_Ca_insen.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR018159. Spectrin/alpha-actinin.
    IPR002017. Spectrin_repeat.
    [Graphical view]
    PANTHERiPTHR11915:SF241. PTHR11915:SF241. 1 hit.
    PfamiPF00307. CH. 2 hits.
    PF13405. EF-hand_6. 1 hit.
    PF08726. EFhand_Ca_insen. 1 hit.
    PF00435. Spectrin. 4 hits.
    [Graphical view]
    SMARTiSM00033. CH. 2 hits.
    SM00054. EFh. 2 hits.
    SM00150. SPEC. 4 hits.
    [Graphical view]
    SUPFAMiSSF47576. SSF47576. 1 hit.
    PROSITEiPS00019. ACTININ_1. 1 hit.
    PS00020. ACTININ_2. 1 hit.
    PS50021. CH. 2 hits.
    PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 2 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform Long (identifier: P18091-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMMENGLSME YGDGYMEQEE EWEREGLLDP AWEKQQKKTF TAWCNSHLRK    50
    AGTAIDNIEE DFRNGLKLML LLEVISGETL PKPDRGKMRF HKIANVNKAL 100
    DFIASKGVHL VSIGAEEIVD GNLKMTLGMI WTIILRFAIQ DISVEEMTAK 150
    EGLLLWCQRK TAPYKNVNVQ NFHLSFKDGL AFCALIHRHR PDLIDYAKLS 200
    KDNPLENLNT AFDVAEKYLD IPRMLDPDDL INTPKPDERA IMTYVSCYYH 250
    AFQGAQQVGN NTALPDERAV MTYVSSYYHC FSGAQKAETA ANRICKVLKV 300
    NQENERLMEE YERLASDLLE WIRRTMPWLN SRQADNSLAG VQKKLEEYRT 350
    YRRKHKPPRV EQKAKLETNF NTLQTKLRLS NRPAYLPTEG KTVSDISNSW 400
    KGLELAEKAF EEWLLAETMR LERLEHLAQK FKHKADAHED WTRGKEEMLQ 450
    SQDFRQCKLN ELKALKKKHE AFESDLAAHQ DRVEQIAAIA QELNTLEYHD 500
    CVSVNARCQR ICDQWDRLGA LTQRRRTALD EAERILEKID ILHLEFAKRA 550
    APFNNWLDGT REDLVDMFIV HTMEEIQGLI QAHDQFKATL GEADKEFNLI 600
    VNLVREVESI VKQHQIPGGL ENPYTTLTAN DMTRKWSDVR QLVPQRDQTL 650
    ANELRKQQNN EMLRRQFAEK ANIVGPWIER QMDAVTAIGM GLQGSLEDQL 700
    HRLKEYEQAV YAYKPNIEEL EKIHQAVQES MIFENRYTNY TMETLRVGWE 750
    QLLTSINRNI NEVENQILTR DSKGISQEQL NEFRSSFNHF DKNRTGRLSP 800
    EEFKSCLVSL GYSIGKDRQG DLDFQRILAV VDPNNTGYVH FDAFLDFMTR 850
    ESTDTDTAEQ VIDSFRILAA DKPYILPDEL RRELPPDQAE YCIQRMPPYK 900
    GPNGVPGALD YMSFSTALYG ETDL 924
    Length:924
    Mass (Da):107,019
    Last modified:February 21, 2001 - v2
    Checksum:i08F8961520328ACE
    GO
    Isoform Non-muscle (identifier: P18091-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         229-260: Missing.
         261-261: N → Q

    Show »
    Length:892
    Mass (Da):103,420
    Checksum:iCDE214DD3B7E5A72
    GO
    Isoform Larval muscle (identifier: P18091-3) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         261-286: NTALPDERAVMTYVSSYYHCFSGAQK → VTHVPEPTRQYTYVPNNYN

    Show »
    Length:917
    Mass (Da):106,373
    Checksum:i31573181B7230DAA
    GO
    Isoform Adult muscle (identifier: P18091-4) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         258-286: Missing.

    Show »
    Length:895
    Mass (Da):103,828
    Checksum:i196879A84FB0E259
    GO
    Isoform A (identifier: P18091-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         231-260: INTPKPDERAIMTYVSCYYHAFQGAQQVGN → Q

    Show »
    Length:895
    Mass (Da):103,763
    Checksum:iFB2D59D86C6B9619
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti409 – 4091A → G in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti457 – 4571C → Y in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti474 – 4741S → C in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti503 – 5031S → C in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti574 – 5741E → V in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti654 – 6541L → R in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti684 – 6918AVTAIGMG → VVTPLVWD in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti711 – 7111Y → H in CAA36042. (PubMed:2112549)Curated
    Sequence conflicti817 – 8171D → E in CAA36042. (PubMed:2112549)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei229 – 26032Missing in isoform Non-muscle. 1 PublicationVSP_000712Add
    BLAST
    Alternative sequencei231 – 26030INTPK…QQVGN → Q in isoform A. 1 PublicationVSP_000713Add
    BLAST
    Alternative sequencei258 – 28629Missing in isoform Adult muscle. 1 PublicationVSP_000715Add
    BLAST
    Alternative sequencei261 – 28626NTALP…SGAQK → VTHVPEPTRQYTYVPNNYN in isoform Larval muscle. CuratedVSP_000716Add
    BLAST
    Alternative sequencei261 – 2611N → Q in isoform Non-muscle. 1 PublicationVSP_000714

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X51753 mRNA. Translation: CAA36042.1.
    AE014298 Genomic DNA. Translation: AAF45705.2.
    AE014298 Genomic DNA. Translation: AAF45706.2.
    AE014298 Genomic DNA. Translation: AAN09068.1.
    AL009192, AL031765 Genomic DNA. Translation: CAA15688.1.
    AL009192, AL031765 Genomic DNA. Translation: CAA15689.1.
    AL031765, AL009192 Genomic DNA. Translation: CAA21120.1.
    AL031765, AL009192 Genomic DNA. Translation: CAA21121.1.
    AY069615 mRNA. Translation: AAL39760.1.
    X64419 mRNA. Translation: CAA45764.1.
    PIRiA35598. FAFFAA.
    T13413.
    T13414.
    RefSeqiNP_001188532.1. NM_001201603.2. [P18091-4]
    NP_001188533.1. NM_001201604.2. [P18091-4]
    NP_001259165.1. NM_001272236.1. [P18091-3]
    NP_001259166.1. NM_001272237.1. [P18091-3]
    NP_001259167.1. NM_001272238.1. [P18091-3]
    NP_477484.2. NM_058136.4. [P18091-5]
    NP_477485.1. NM_058137.5. [P18091-3]
    NP_726784.1. NM_166920.2. [P18091-4]
    UniGeneiDm.25.

    Genome annotation databases

    GeneIDi31166.
    KEGGidme:Dmel_CG4376.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X51753 mRNA. Translation: CAA36042.1 .
    AE014298 Genomic DNA. Translation: AAF45705.2 .
    AE014298 Genomic DNA. Translation: AAF45706.2 .
    AE014298 Genomic DNA. Translation: AAN09068.1 .
    AL009192 , AL031765 Genomic DNA. Translation: CAA15688.1 .
    AL009192 , AL031765 Genomic DNA. Translation: CAA15689.1 .
    AL031765 , AL009192 Genomic DNA. Translation: CAA21120.1 .
    AL031765 , AL009192 Genomic DNA. Translation: CAA21121.1 .
    AY069615 mRNA. Translation: AAL39760.1 .
    X64419 mRNA. Translation: CAA45764.1 .
    PIRi A35598. FAFFAA.
    T13413.
    T13414.
    RefSeqi NP_001188532.1. NM_001201603.2. [P18091-4 ]
    NP_001188533.1. NM_001201604.2. [P18091-4 ]
    NP_001259165.1. NM_001272236.1. [P18091-3 ]
    NP_001259166.1. NM_001272237.1. [P18091-3 ]
    NP_001259167.1. NM_001272238.1. [P18091-3 ]
    NP_477484.2. NM_058136.4. [P18091-5 ]
    NP_477485.1. NM_058137.5. [P18091-3 ]
    NP_726784.1. NM_166920.2. [P18091-4 ]
    UniGenei Dm.25.

    3D structure databases

    ProteinModelPortali P18091.
    SMRi P18091. Positions 31-255, 300-924.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 57710. 35 interactions.
    DIPi DIP-22313N.

    Proteomic databases

    PaxDbi P18091.
    PRIDEi P18091.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 31166.
    KEGGi dme:Dmel_CG4376.

    Organism-specific databases

    CTDi 31166.
    FlyBasei FBgn0000667. Actn.

    Phylogenomic databases

    eggNOGi COG5069.
    InParanoidi P18091.
    KOi K05699.
    OMAi WIRRTMP.
    OrthoDBi EOG72C4ZJ.
    PhylomeDBi P18091.

    Enzyme and pathway databases

    Reactomei REACT_184300. Syndecan interactions.

    Miscellaneous databases

    ChiTaRSi Actn. drosophila.
    GenomeRNAii 31166.
    NextBioi 772252.
    PROi P18091.

    Gene expression databases

    Bgeei P18091.

    Family and domain databases

    Gene3Di 1.10.238.10. 2 hits.
    1.10.418.10. 2 hits.
    InterProi IPR001589. Actinin_actin-bd_CS.
    IPR026921. Alpha-actinin_1.
    IPR001715. CH-domain.
    IPR011992. EF-hand-dom_pair.
    IPR014837. EF-hand_Ca_insen.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR018159. Spectrin/alpha-actinin.
    IPR002017. Spectrin_repeat.
    [Graphical view ]
    PANTHERi PTHR11915:SF241. PTHR11915:SF241. 1 hit.
    Pfami PF00307. CH. 2 hits.
    PF13405. EF-hand_6. 1 hit.
    PF08726. EFhand_Ca_insen. 1 hit.
    PF00435. Spectrin. 4 hits.
    [Graphical view ]
    SMARTi SM00033. CH. 2 hits.
    SM00054. EFh. 2 hits.
    SM00150. SPEC. 4 hits.
    [Graphical view ]
    SUPFAMi SSF47576. SSF47576. 1 hit.
    PROSITEi PS00019. ACTININ_1. 1 hit.
    PS00020. ACTININ_2. 1 hit.
    PS50021. CH. 2 hits.
    PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular genetics of Drosophila alpha-actinin: mutant alleles disrupt Z disc integrity and muscle insertions."
      Fyrberg E.A., Kelly M., Ball E., Fyrberg C., Reedy M.C.
      J. Cell Biol. 110:1999-2011(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ADULT MUSCLE), FUNCTION.
      Strain: Canton-S.
    2. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    3. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS LONG AND ADULT MUSCLE).
      Strain: Oregon-R.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
      Strain: Berkeley.
      Tissue: Embryo.
    6. "Perturbations of Drosophila alpha-actinin cause muscle paralysis, weakness, and atrophy but do not confer obvious nonmuscle phenotypes."
      Roulier E.M., Fyrberg C., Fyrberg E.
      J. Cell Biol. 116:911-922(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 229-286 (ISOFORM NON-MUSCLE), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: Oregon-R.
      Tissue: Embryo.
    7. "A Drosophila melanogaster model of spinal muscular atrophy reveals a function for SMN in striated muscle."
      Rajendra T.K., Gonsalvez G.B., Walker M.P., Shpargel K.B., Salz H.K., Matera A.G.
      J. Cell Biol. 176:831-841(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SMN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiACTN_DROME
    AccessioniPrimary (citable) accession number: P18091
    Secondary accession number(s): O46044
    , O46045, Q24370, Q8T024, Q9W536, Q9W537
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1990
    Last sequence update: February 21, 2001
    Last modified: October 1, 2014
    This is version 149 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3