Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P18091

- ACTN_DROME

UniProt

P18091 - ACTN_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Alpha-actinin, sarcomeric

Gene

Actn

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi791 – 802121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi832 – 843122PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. actin binding Source: UniProtKB
  2. calcium ion binding Source: InterPro

GO - Biological processi

  1. actin crosslink formation Source: InterPro
  2. actin cytoskeleton reorganization Source: FlyBase
  3. actin filament bundle assembly Source: InterPro
  4. cytoskeletal anchoring at plasma membrane Source: FlyBase
  5. flight behavior Source: FlyBase
  6. sarcomere organization Source: FlyBase
Complete GO annotation...

Keywords - Ligandi

Actin-binding, Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_184300. Syndecan interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-actinin, sarcomeric
Alternative name(s):
F-actin cross-linking protein
Gene namesi
Name:Actn
Synonyms:fliA, l(1)2Cb
ORF Names:CG4376
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000667. Actn.

Subcellular locationi

CytoplasmmyofibrilsarcomereZ line 1 Publication
Note: Colocalizes with Smn at the Z-line of indirect flight muscles.

GO - Cellular componenti

  1. focal adhesion Source: FlyBase
  2. Z disc Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 924924Alpha-actinin, sarcomericPRO_0000073447Add
BLAST

Proteomic databases

PaxDbiP18091.
PRIDEiP18091.

Expressioni

Tissue specificityi

Larval muscle isoform is expressed in the larval body wall, adult muscles of the head and abdomen and supercontractile muscles of the larva and adult. Adult muscle isoform accumulates within adult fibrillar and tubular muscles.2 Publications

Developmental stagei

Larval muscle isoform is found in the larvae and adults, the adult muscle isoform in adults only.1 Publication

Gene expression databases

BgeeiP18091.
ExpressionAtlasiP18091. differential.

Interactioni

Subunit structurei

Homodimer; antiparallel. Interacts with Smn; the interaction occurs in adult thoracic tissues.1 Publication

Protein-protein interaction databases

BioGridi57710. 35 interactions.
DIPiDIP-22313N.

Structurei

3D structure databases

ProteinModelPortaliP18091.
SMRiP18091. Positions 31-255, 300-924.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 250250Actin-bindingAdd
BLAST
Domaini34 – 138105CH 1PROSITE-ProRule annotationAdd
BLAST
Domaini147 – 250104CH 2PROSITE-ProRule annotationAdd
BLAST
Repeati251 – 395145Spectrin 1Add
BLAST
Repeati396 – 510115Spectrin 2Add
BLAST
Repeati511 – 631121Spectrin 3Add
BLAST
Repeati632 – 744113Spectrin 4Add
BLAST
Domaini778 – 81336EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini819 – 85436EF-hand 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the alpha-actinin family.Curated
Contains 1 actin-binding domain.Curated
Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 4 spectrin repeats.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5069.
InParanoidiP18091.
KOiK05699.
OMAiWIRRTMP.
OrthoDBiEOG72C4ZJ.
PhylomeDBiP18091.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
1.10.418.10. 2 hits.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR026921. Alpha-actinin_1.
IPR001715. CH-domain.
IPR011992. EF-hand-dom_pair.
IPR014837. EF-hand_Ca_insen.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR018159. Spectrin/alpha-actinin.
IPR002017. Spectrin_repeat.
[Graphical view]
PANTHERiPTHR11915:SF241. PTHR11915:SF241. 1 hit.
PfamiPF00307. CH. 2 hits.
PF13405. EF-hand_6. 1 hit.
PF08726. EFhand_Ca_insen. 1 hit.
PF00435. Spectrin. 4 hits.
[Graphical view]
SMARTiSM00033. CH. 2 hits.
SM00054. EFh. 2 hits.
SM00150. SPEC. 4 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform Long (identifier: P18091) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMMENGLSME YGDGYMEQEE EWEREGLLDP AWEKQQKKTF TAWCNSHLRK
60 70 80 90 100
AGTAIDNIEE DFRNGLKLML LLEVISGETL PKPDRGKMRF HKIANVNKAL
110 120 130 140 150
DFIASKGVHL VSIGAEEIVD GNLKMTLGMI WTIILRFAIQ DISVEEMTAK
160 170 180 190 200
EGLLLWCQRK TAPYKNVNVQ NFHLSFKDGL AFCALIHRHR PDLIDYAKLS
210 220 230 240 250
KDNPLENLNT AFDVAEKYLD IPRMLDPDDL INTPKPDERA IMTYVSCYYH
260 270 280 290 300
AFQGAQQVGN NTALPDERAV MTYVSSYYHC FSGAQKAETA ANRICKVLKV
310 320 330 340 350
NQENERLMEE YERLASDLLE WIRRTMPWLN SRQADNSLAG VQKKLEEYRT
360 370 380 390 400
YRRKHKPPRV EQKAKLETNF NTLQTKLRLS NRPAYLPTEG KTVSDISNSW
410 420 430 440 450
KGLELAEKAF EEWLLAETMR LERLEHLAQK FKHKADAHED WTRGKEEMLQ
460 470 480 490 500
SQDFRQCKLN ELKALKKKHE AFESDLAAHQ DRVEQIAAIA QELNTLEYHD
510 520 530 540 550
CVSVNARCQR ICDQWDRLGA LTQRRRTALD EAERILEKID ILHLEFAKRA
560 570 580 590 600
APFNNWLDGT REDLVDMFIV HTMEEIQGLI QAHDQFKATL GEADKEFNLI
610 620 630 640 650
VNLVREVESI VKQHQIPGGL ENPYTTLTAN DMTRKWSDVR QLVPQRDQTL
660 670 680 690 700
ANELRKQQNN EMLRRQFAEK ANIVGPWIER QMDAVTAIGM GLQGSLEDQL
710 720 730 740 750
HRLKEYEQAV YAYKPNIEEL EKIHQAVQES MIFENRYTNY TMETLRVGWE
760 770 780 790 800
QLLTSINRNI NEVENQILTR DSKGISQEQL NEFRSSFNHF DKNRTGRLSP
810 820 830 840 850
EEFKSCLVSL GYSIGKDRQG DLDFQRILAV VDPNNTGYVH FDAFLDFMTR
860 870 880 890 900
ESTDTDTAEQ VIDSFRILAA DKPYILPDEL RRELPPDQAE YCIQRMPPYK
910 920
GPNGVPGALD YMSFSTALYG ETDL
Length:924
Mass (Da):107,019
Last modified:February 21, 2001 - v2
Checksum:i08F8961520328ACE
GO
Isoform Non-muscle (identifier: P18091-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-260: Missing.
     261-261: N → Q

Show »
Length:892
Mass (Da):103,420
Checksum:iCDE214DD3B7E5A72
GO
Isoform Larval muscle (identifier: P18091-3) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     261-286: NTALPDERAVMTYVSSYYHCFSGAQK → VTHVPEPTRQYTYVPNNYN

Show »
Length:917
Mass (Da):106,373
Checksum:i31573181B7230DAA
GO
Isoform Adult muscle (identifier: P18091-4) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     258-286: Missing.

Show »
Length:895
Mass (Da):103,828
Checksum:i196879A84FB0E259
GO
Isoform A (identifier: P18091-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-260: INTPKPDERAIMTYVSCYYHAFQGAQQVGN → Q

Show »
Length:895
Mass (Da):103,763
Checksum:iFB2D59D86C6B9619
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti409 – 4091A → G in CAA36042. (PubMed:2112549)Curated
Sequence conflicti457 – 4571C → Y in CAA36042. (PubMed:2112549)Curated
Sequence conflicti474 – 4741S → C in CAA36042. (PubMed:2112549)Curated
Sequence conflicti503 – 5031S → C in CAA36042. (PubMed:2112549)Curated
Sequence conflicti574 – 5741E → V in CAA36042. (PubMed:2112549)Curated
Sequence conflicti654 – 6541L → R in CAA36042. (PubMed:2112549)Curated
Sequence conflicti684 – 6918AVTAIGMG → VVTPLVWD in CAA36042. (PubMed:2112549)Curated
Sequence conflicti711 – 7111Y → H in CAA36042. (PubMed:2112549)Curated
Sequence conflicti817 – 8171D → E in CAA36042. (PubMed:2112549)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei229 – 26032Missing in isoform Non-muscle. 1 PublicationVSP_000712Add
BLAST
Alternative sequencei231 – 26030INTPK…QQVGN → Q in isoform A. 1 PublicationVSP_000713Add
BLAST
Alternative sequencei258 – 28629Missing in isoform Adult muscle. 1 PublicationVSP_000715Add
BLAST
Alternative sequencei261 – 28626NTALP…SGAQK → VTHVPEPTRQYTYVPNNYN in isoform Larval muscle. CuratedVSP_000716Add
BLAST
Alternative sequencei261 – 2611N → Q in isoform Non-muscle. 1 PublicationVSP_000714

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X51753 mRNA. Translation: CAA36042.1.
AE014298 Genomic DNA. Translation: AAF45705.2.
AE014298 Genomic DNA. Translation: AAF45706.2.
AE014298 Genomic DNA. Translation: AAN09068.1.
AL009192, AL031765 Genomic DNA. Translation: CAA15688.1.
AL009192, AL031765 Genomic DNA. Translation: CAA15689.1.
AL031765, AL009192 Genomic DNA. Translation: CAA21120.1.
AL031765, AL009192 Genomic DNA. Translation: CAA21121.1.
AY069615 mRNA. Translation: AAL39760.1.
X64419 mRNA. Translation: CAA45764.1.
PIRiA35598. FAFFAA.
T13413.
T13414.
RefSeqiNP_001188532.1. NM_001201603.2. [P18091-4]
NP_001188533.1. NM_001201604.2. [P18091-4]
NP_001259165.1. NM_001272236.1. [P18091-3]
NP_001259166.1. NM_001272237.1. [P18091-3]
NP_001259167.1. NM_001272238.1. [P18091-3]
NP_477484.2. NM_058136.4. [P18091-5]
NP_477485.1. NM_058137.6. [P18091-3]
NP_726784.1. NM_166920.2. [P18091-4]
UniGeneiDm.25.

Genome annotation databases

GeneIDi31166.
KEGGidme:Dmel_CG4376.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X51753 mRNA. Translation: CAA36042.1 .
AE014298 Genomic DNA. Translation: AAF45705.2 .
AE014298 Genomic DNA. Translation: AAF45706.2 .
AE014298 Genomic DNA. Translation: AAN09068.1 .
AL009192 , AL031765 Genomic DNA. Translation: CAA15688.1 .
AL009192 , AL031765 Genomic DNA. Translation: CAA15689.1 .
AL031765 , AL009192 Genomic DNA. Translation: CAA21120.1 .
AL031765 , AL009192 Genomic DNA. Translation: CAA21121.1 .
AY069615 mRNA. Translation: AAL39760.1 .
X64419 mRNA. Translation: CAA45764.1 .
PIRi A35598. FAFFAA.
T13413.
T13414.
RefSeqi NP_001188532.1. NM_001201603.2. [P18091-4 ]
NP_001188533.1. NM_001201604.2. [P18091-4 ]
NP_001259165.1. NM_001272236.1. [P18091-3 ]
NP_001259166.1. NM_001272237.1. [P18091-3 ]
NP_001259167.1. NM_001272238.1. [P18091-3 ]
NP_477484.2. NM_058136.4. [P18091-5 ]
NP_477485.1. NM_058137.6. [P18091-3 ]
NP_726784.1. NM_166920.2. [P18091-4 ]
UniGenei Dm.25.

3D structure databases

ProteinModelPortali P18091.
SMRi P18091. Positions 31-255, 300-924.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 57710. 35 interactions.
DIPi DIP-22313N.

Proteomic databases

PaxDbi P18091.
PRIDEi P18091.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 31166.
KEGGi dme:Dmel_CG4376.

Organism-specific databases

CTDi 31166.
FlyBasei FBgn0000667. Actn.

Phylogenomic databases

eggNOGi COG5069.
InParanoidi P18091.
KOi K05699.
OMAi WIRRTMP.
OrthoDBi EOG72C4ZJ.
PhylomeDBi P18091.

Enzyme and pathway databases

Reactomei REACT_184300. Syndecan interactions.

Miscellaneous databases

ChiTaRSi Actn. drosophila.
GenomeRNAii 31166.
NextBioi 772252.
PROi P18091.

Gene expression databases

Bgeei P18091.
ExpressionAtlasi P18091. differential.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
1.10.418.10. 2 hits.
InterProi IPR001589. Actinin_actin-bd_CS.
IPR026921. Alpha-actinin_1.
IPR001715. CH-domain.
IPR011992. EF-hand-dom_pair.
IPR014837. EF-hand_Ca_insen.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR018159. Spectrin/alpha-actinin.
IPR002017. Spectrin_repeat.
[Graphical view ]
PANTHERi PTHR11915:SF241. PTHR11915:SF241. 1 hit.
Pfami PF00307. CH. 2 hits.
PF13405. EF-hand_6. 1 hit.
PF08726. EFhand_Ca_insen. 1 hit.
PF00435. Spectrin. 4 hits.
[Graphical view ]
SMARTi SM00033. CH. 2 hits.
SM00054. EFh. 2 hits.
SM00150. SPEC. 4 hits.
[Graphical view ]
SUPFAMi SSF47576. SSF47576. 1 hit.
PROSITEi PS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular genetics of Drosophila alpha-actinin: mutant alleles disrupt Z disc integrity and muscle insertions."
    Fyrberg E.A., Kelly M., Ball E., Fyrberg C., Reedy M.C.
    J. Cell Biol. 110:1999-2011(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ADULT MUSCLE), FUNCTION.
    Strain: Canton-S.
  2. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  3. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS LONG AND ADULT MUSCLE).
    Strain: Oregon-R.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: Berkeley.
    Tissue: Embryo.
  6. "Perturbations of Drosophila alpha-actinin cause muscle paralysis, weakness, and atrophy but do not confer obvious nonmuscle phenotypes."
    Roulier E.M., Fyrberg C., Fyrberg E.
    J. Cell Biol. 116:911-922(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 229-286 (ISOFORM NON-MUSCLE), ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: Oregon-R.
    Tissue: Embryo.
  7. "A Drosophila melanogaster model of spinal muscular atrophy reveals a function for SMN in striated muscle."
    Rajendra T.K., Gonsalvez G.B., Walker M.P., Shpargel K.B., Salz H.K., Matera A.G.
    J. Cell Biol. 176:831-841(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SMN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiACTN_DROME
AccessioniPrimary (citable) accession number: P18091
Secondary accession number(s): O46044
, O46045, Q24370, Q8T024, Q9W536, Q9W537
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: February 21, 2001
Last modified: October 29, 2014
This is version 150 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3