Reviewed,
UniProtKB/Swiss-Prot P18091 (ACTN_DROME)
Last modified
December 15, 2009.
Version 110.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Alpha-actinin, sarcomeric Alternative name(s): F-actin cross-linking protein | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Complete proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora |
Protein attributes
| Sequence length | 924 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. |
| Subunit structure | Homodimer; antiparallel. |
| Tissue specificity | Larval muscle isoform is expressed in the larval body wall, adult muscles of the head and abdomen and supercontractile muscles of the larva and adult. Adult muscle isoform accumulates within adult fibrillar and tubular muscles. |
| Developmental stage | Larval muscle isoform is found in the larvae and adults, the adult muscle isoform in adults only. |
| Sequence similarities | Belongs to the alpha-actinin family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 2 EF-hand domains. Contains 4 spectrin repeats. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Actin-binding Calcium |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | actin cytoskeleton reorganization Inferred from mutant phenotype. Source: FlyBase flight behaviorInferred from mutant phenotype. Source: FlyBase |
| Molecular function | actin binding Inferred from physical interaction. Source: UniProtKB calcium ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform Long (identifier: P18091-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Non-muscle (identifier: P18091-2) The sequence of this isoform differs from the canonical sequence as follows: 229-260: Missing. 261-261: N → Q | ||||||
| Isoform Larval muscle (identifier: P18091-3) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 261-286: NTALPDERAVMTYVSSYYHCFSGAQK → VTHVPEPTRQYTYVPNNYN | ||||||
| Isoform Adult muscle (identifier: P18091-4) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 258-286: Missing. | ||||||
| Isoform A (identifier: P18091-5) The sequence of this isoform differs from the canonical sequence as follows: 231-260: INTPKPDERAIMTYVSCYYHAFQGAQQVGN → Q |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 924 | 924 | Alpha-actinin, sarcomeric | PRO_0000073447 | |||||
Regions | |||||||||
| Domain | 1 – 250 | 250 | Actin-binding | ||||||
| Domain | 34 – 138 | 105 | CH 1 | ||||||
| Domain | 147 – 250 | 104 | CH 2 | ||||||
| Repeat | 251 – 395 | 145 | Spectrin 1 | ||||||
| Repeat | 396 – 510 | 115 | Spectrin 2 | ||||||
| Repeat | 511 – 631 | 121 | Spectrin 3 | ||||||
| Repeat | 632 – 744 | 113 | Spectrin 4 | ||||||
| Domain | 778 – 813 | 36 | EF-hand 1 | ||||||
| Domain | 819 – 854 | 36 | EF-hand 2 | ||||||
| Calcium binding | 791 – 802 | 12 | 1 By similarity | ||||||
| Calcium binding | 832 – 843 | 12 | 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 229 – 260 | 32 | Missing in isoform Non-muscle. | VSP_000712 | |||||
| Alternative sequence | 231 – 260 | 30 | INTPK…QQVGN → Q in isoform A. | VSP_000713 | |||||
| Alternative sequence | 258 – 286 | 29 | Missing in isoform Adult muscle. | VSP_000715 | |||||
| Alternative sequence | 261 – 286 | 26 | NTALP…SGAQK → VTHVPEPTRQYTYVPNNYN in isoform Larval muscle. | VSP_000716 | |||||
| Alternative sequence | 261 | 1 | N → Q in isoform Non-muscle. | VSP_000714 | |||||
Experimental info | |||||||||
| Sequence conflict | 409 | 1 | A → G in CAA36042. Ref.1 | ||||||
| Sequence conflict | 457 | 1 | C → Y in CAA36042. Ref.1 | ||||||
| Sequence conflict | 474 | 1 | S → C in CAA36042. Ref.1 | ||||||
| Sequence conflict | 503 | 1 | S → C in CAA36042. Ref.1 | ||||||
| Sequence conflict | 574 | 1 | E → V in CAA36042. Ref.1 | ||||||
| Sequence conflict | 654 | 1 | L → R in CAA36042. Ref.1 | ||||||
| Sequence conflict | 684 – 691 | 8 | AVTAIGMG → VVTPLVWD in CAA36042. Ref.1 | ||||||
| Sequence conflict | 711 | 1 | Y → H in CAA36042. Ref.1 | ||||||
| Sequence conflict | 817 | 1 | D → E in CAA36042. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular genetics of Drosophila alpha-actinin: mutant alleles disrupt Z disc integrity and muscle insertions." Fyrberg E.A., Kelly M., Ball E., Fyrberg C., Reedy M.C. J. Cell Biol. 110:1999-2011(1990) [PubMed: 2112549] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ADULT MUSCLE). Strain: Canton-S. |
| [2] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed: 10731132] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [3] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed: 12537572] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. |
| [4] | "From sequence to chromosome: the tip of the X chromosome of D. melanogaster." Benos P.V., Gatt M.K., Ashburner M., Murphy L., Harris D., Barrell B.G., Ferraz C., Vidal S., Brun C., Demailles J., Cadieu E., Dreano S., Gloux S., Lelaure V., Mottier S., Galibert F., Borkova D., Minana B. Glover D.M.Science 287:2220-2222(2000) [PubMed: 10731137] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS LONG AND ADULT MUSCLE). Strain: Oregon-R. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed: 12537569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: Berkeley. Tissue: Embryo. |
| [6] | "Perturbations of Drosophila alpha-actinin cause muscle paralysis, weakness, and atrophy but do not confer obvious nonmuscle phenotypes." Roulier E.M., Fyrberg C., Fyrberg E. J. Cell Biol. 116:911-922(1992) [PubMed: 1734023] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 229-286 (ISOFORM NON-MUSCLE), ALTERNATIVE SPLICING. Strain: Oregon-R. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| X51753 mRNA. Translation: CAA36042.1. AE014298 Genomic DNA. Translation: AAF45705.2. AE014298 Genomic DNA. Translation: AAF45706.2. AE014298 Genomic DNA. Translation: AAN09068.1. AL009192, AL031765 Genomic DNA. Translation: CAA15688.1. AL009192, AL031765 Genomic DNA. Translation: CAA15689.1. AL031765, AL009192 Genomic DNA. Translation: CAA21120.1. AL031765, AL009192 Genomic DNA. Translation: CAA21121.1. AY069615 mRNA. Translation: AAL39760.1. X64419 mRNA. Translation: CAA45764.1. | |
| PIR | FAFFAA. A35598. T13413. T13414. |
| RefSeq | NP_477484.2. NP_477485.1. NP_726784.1. |
| UniGene | Dm.33411 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-22313N. |
| IntAct | P18091. 10 interactions. |
| STRING | P18091. |
Genome annotation databases | |
| Ensembl | FBtr0070343; FBpp0070329; FBgn0000667; Drosophila melanogaster. [Genome view] FBtr0070344; FBpp0070330; FBgn0000667; Drosophila melanogaster. [Genome view] FBtr0070345; FBpp0070331; FBgn0000667; Drosophila melanogaster. [Genome view] |
| GeneID | 31166. |
| KEGG | dme:Dmel_CG4376. |
Organism-specific databases | |
| CTD | 31166. |
| FlyBase | FBgn0000667. Actn. |
Phylogenomic databases | |
| InParanoid | P18091. |
| OMA | INNAWGG. |
| OrthoDB | EOG92JNZZ. |
Gene expression databases | |
| ArrayExpress | P18091. |
| Bgee | P18091. |
| GermOnline | CG4376. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR001589. Actinin_actin-bd_CS. IPR016146. Calponin-homology. IPR001715. Calponin_act_bd. IPR014837. EF-hand_Ca_insen. IPR011992. EF-Hand_type. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca_bd. IPR018248. EF_Hand_dom. IPR018159. Spectrin/alpha-actinin. IPR002017. Spectrin_repeat. [Graphical view] |
| Gene3D | G3DSA:1.10.418.10. Calponin-homology. 2 hits. G3DSA:1.10.238.10. EF-Hand_type. 2 hits. |
| Pfam | PF00307. CH. 2 hits. PF00036. efhand. 1 hit. PF08726. efhand_Ca_insen. 1 hit. PF00435. Spectrin. 4 hits. [Graphical view] |
| SMART | SM00033. CH. 2 hits. SM00054. EFh. 2 hits. SM00150. SPEC. 4 hits. [Graphical view] |
| PROSITE | PS00019. ACTININ_1. 1 hit. PS00020. ACTININ_2. 1 hit. PS50021. CH. 2 hits. PS00018. EF_HAND_1. 1 hit. PS50222. EF_HAND_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 772252. |
Entry information
| Entry name | ACTN_DROME | ||||||||
| Accession | Primary (citable) accession number: P18091 Secondary accession number(s): O46044 Q9W537 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with


