Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-actinin, sarcomeric

Gene

Actn

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi791 – 8021PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi832 – 8432PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

  • actin binding Source: UniProtKB
  • actin filament binding Source: UniProtKB
  • calcium ion binding Source: InterPro

GO - Biological processi

  • actin cytoskeleton reorganization Source: FlyBase
  • actin filament bundle assembly Source: UniProtKB
  • cytoskeletal anchoring at plasma membrane Source: FlyBase
  • sarcomere organization Source: FlyBase

Keywordsi

Molecular functionActin-binding
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-DME-114608 Platelet degranulation
R-DME-438066 Unblocking of NMDA receptor, glutamate binding and activation
R-DME-442729 CREB phosphorylation through the activation of CaMKII
R-DME-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-DME-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
R-DME-5673001 RAF/MAP kinase cascade

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-actinin, sarcomeric
Alternative name(s):
F-actin cross-linking protein
Gene namesi
Name:Actn
Synonyms:fliA, l(1)2Cb
ORF Names:CG4376
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000667 Actn

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000734471 – 924Alpha-actinin, sarcomericAdd BLAST924

Proteomic databases

PaxDbiP18091
PRIDEiP18091

Expressioni

Tissue specificityi

Larval muscle isoform is expressed in the larval body wall, adult muscles of the head and abdomen and supercontractile muscles of the larva and adult. Adult muscle isoform accumulates within adult fibrillar and tubular muscles.2 Publications

Developmental stagei

Larval muscle isoform is found in the larvae and adults, the adult muscle isoform in adults only.1 Publication

Gene expression databases

BgeeiFBgn0000667
ExpressionAtlasiP18091 baseline and differential
GenevisibleiP18091 DM

Interactioni

Subunit structurei

Homodimer; antiparallel. Interacts with Smn; the interaction occurs in adult thoracic tissues.1 Publication

GO - Molecular functioni

  • actin binding Source: UniProtKB
  • actin filament binding Source: UniProtKB

Protein-protein interaction databases

BioGridi57710, 45 interactors
DIPiDIP-22313N
IntActiP18091, 12 interactors
STRINGi7227.FBpp0070331

Structurei

3D structure databases

ProteinModelPortaliP18091
SMRiP18091
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini34 – 138Calponin-homology (CH) 1PROSITE-ProRule annotationAdd BLAST105
Domaini147 – 253Calponin-homology (CH) 2PROSITE-ProRule annotationAdd BLAST107
Repeati251 – 395Spectrin 1Add BLAST145
Repeati396 – 510Spectrin 2Add BLAST115
Repeati511 – 631Spectrin 3Add BLAST121
Repeati632 – 744Spectrin 4Add BLAST113
Domaini778 – 813EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini819 – 854EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 250Actin-bindingAdd BLAST250

Sequence similaritiesi

Belongs to the alpha-actinin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0035 Eukaryota
COG5069 LUCA
GeneTreeiENSGT00760000118813
InParanoidiP18091
KOiK05699
OMAiCKWLNTK
OrthoDBiEOG091G020R
PhylomeDBiP18091

Family and domain databases

CDDicd00014 CH, 2 hits
cd00051 EFh, 1 hit
Gene3Di1.10.418.10, 2 hits
InterProiView protein in InterPro
IPR001589 Actinin_actin-bd_CS
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR011992 EF-hand-dom_pair
IPR014837 EF-hand_Ca_insen
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR018159 Spectrin/alpha-actinin
IPR002017 Spectrin_repeat
PfamiView protein in Pfam
PF00307 CH, 2 hits
PF13405 EF-hand_6, 1 hit
PF08726 EFhand_Ca_insen, 1 hit
PF00435 Spectrin, 4 hits
SMARTiView protein in SMART
SM00033 CH, 2 hits
SM00054 EFh, 2 hits
SM00150 SPEC, 4 hits
SUPFAMiSSF47473 SSF47473, 1 hit
SSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS00019 ACTININ_1, 1 hit
PS00020 ACTININ_2, 1 hit
PS50021 CH, 2 hits
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform Long (identifier: P18091-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMMENGLSME YGDGYMEQEE EWEREGLLDP AWEKQQKKTF TAWCNSHLRK
60 70 80 90 100
AGTAIDNIEE DFRNGLKLML LLEVISGETL PKPDRGKMRF HKIANVNKAL
110 120 130 140 150
DFIASKGVHL VSIGAEEIVD GNLKMTLGMI WTIILRFAIQ DISVEEMTAK
160 170 180 190 200
EGLLLWCQRK TAPYKNVNVQ NFHLSFKDGL AFCALIHRHR PDLIDYAKLS
210 220 230 240 250
KDNPLENLNT AFDVAEKYLD IPRMLDPDDL INTPKPDERA IMTYVSCYYH
260 270 280 290 300
AFQGAQQVGN NTALPDERAV MTYVSSYYHC FSGAQKAETA ANRICKVLKV
310 320 330 340 350
NQENERLMEE YERLASDLLE WIRRTMPWLN SRQADNSLAG VQKKLEEYRT
360 370 380 390 400
YRRKHKPPRV EQKAKLETNF NTLQTKLRLS NRPAYLPTEG KTVSDISNSW
410 420 430 440 450
KGLELAEKAF EEWLLAETMR LERLEHLAQK FKHKADAHED WTRGKEEMLQ
460 470 480 490 500
SQDFRQCKLN ELKALKKKHE AFESDLAAHQ DRVEQIAAIA QELNTLEYHD
510 520 530 540 550
CVSVNARCQR ICDQWDRLGA LTQRRRTALD EAERILEKID ILHLEFAKRA
560 570 580 590 600
APFNNWLDGT REDLVDMFIV HTMEEIQGLI QAHDQFKATL GEADKEFNLI
610 620 630 640 650
VNLVREVESI VKQHQIPGGL ENPYTTLTAN DMTRKWSDVR QLVPQRDQTL
660 670 680 690 700
ANELRKQQNN EMLRRQFAEK ANIVGPWIER QMDAVTAIGM GLQGSLEDQL
710 720 730 740 750
HRLKEYEQAV YAYKPNIEEL EKIHQAVQES MIFENRYTNY TMETLRVGWE
760 770 780 790 800
QLLTSINRNI NEVENQILTR DSKGISQEQL NEFRSSFNHF DKNRTGRLSP
810 820 830 840 850
EEFKSCLVSL GYSIGKDRQG DLDFQRILAV VDPNNTGYVH FDAFLDFMTR
860 870 880 890 900
ESTDTDTAEQ VIDSFRILAA DKPYILPDEL RRELPPDQAE YCIQRMPPYK
910 920
GPNGVPGALD YMSFSTALYG ETDL
Length:924
Mass (Da):107,019
Last modified:February 21, 2001 - v2
Checksum:i08F8961520328ACE
GO
Isoform Non-muscle (identifier: P18091-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-260: Missing.
     261-261: N → Q

Show »
Length:892
Mass (Da):103,420
Checksum:iCDE214DD3B7E5A72
GO
Isoform Larval muscle (identifier: P18091-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     261-286: NTALPDERAVMTYVSSYYHCFSGAQK → VTHVPEPTRQYTYVPNNYN

Show »
Length:917
Mass (Da):106,373
Checksum:i31573181B7230DAA
GO
Isoform Adult muscle (identifier: P18091-4) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     258-286: Missing.

Show »
Length:895
Mass (Da):103,828
Checksum:i196879A84FB0E259
GO
Isoform A (identifier: P18091-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-260: INTPKPDERAIMTYVSCYYHAFQGAQQVGN → Q

Show »
Length:895
Mass (Da):103,763
Checksum:iFB2D59D86C6B9619
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti409A → G in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti457C → Y in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti474S → C in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti503S → C in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti574E → V in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti654L → R in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti684 – 691AVTAIGMG → VVTPLVWD in CAA36042 (PubMed:2112549).Curated8
Sequence conflicti711Y → H in CAA36042 (PubMed:2112549).Curated1
Sequence conflicti817D → E in CAA36042 (PubMed:2112549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000712229 – 260Missing in isoform Non-muscle. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_000713231 – 260INTPK…QQVGN → Q in isoform A. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_000715258 – 286Missing in isoform Adult muscle. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000716261 – 286NTALP…SGAQK → VTHVPEPTRQYTYVPNNYN in isoform Larval muscle. CuratedAdd BLAST26
Alternative sequenceiVSP_000714261N → Q in isoform Non-muscle. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X51753 mRNA Translation: CAA36042.1
AE014298 Genomic DNA Translation: AAF45705.2
AE014298 Genomic DNA Translation: AAF45706.2
AE014298 Genomic DNA Translation: AAN09068.1
AL009192, AL031765 Genomic DNA Translation: CAA15688.1
AL009192, AL031765 Genomic DNA Translation: CAA15689.1
AL031765, AL009192 Genomic DNA Translation: CAA21120.1
AL031765, AL009192 Genomic DNA Translation: CAA21121.1
AY069615 mRNA Translation: AAL39760.1
X64419 mRNA Translation: CAA45764.1
PIRiA35598 FAFFAA
T13413
T13414
RefSeqiNP_001188532.1, NM_001201603.2 [P18091-4]
NP_001188533.1, NM_001201604.2 [P18091-4]
NP_001259165.1, NM_001272236.1 [P18091-3]
NP_001259166.1, NM_001272237.1 [P18091-3]
NP_001259167.1, NM_001272238.1 [P18091-3]
NP_477484.2, NM_058136.4 [P18091-5]
NP_477485.1, NM_058137.6 [P18091-3]
NP_726784.1, NM_166920.2 [P18091-4]
UniGeneiDm.25

Genome annotation databases

EnsemblMetazoaiFBtr0070343; FBpp0070329; FBgn0000667 [P18091-4]
FBtr0070344; FBpp0070330; FBgn0000667 [P18091-5]
FBtr0070345; FBpp0070331; FBgn0000667 [P18091-3]
FBtr0303048; FBpp0292167; FBgn0000667 [P18091-4]
FBtr0310658; FBpp0302778; FBgn0000667 [P18091-3]
FBtr0310659; FBpp0302779; FBgn0000667 [P18091-3]
FBtr0333801; FBpp0305935; FBgn0000667 [P18091-4]
FBtr0333802; FBpp0305936; FBgn0000667 [P18091-3]
GeneIDi31166
KEGGidme:Dmel_CG4376

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiACTN_DROME
AccessioniPrimary (citable) accession number: P18091
Secondary accession number(s): O46044
, O46045, Q24370, Q8T024, Q9W536, Q9W537
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1990
Last sequence update: February 21, 2001
Last modified: May 23, 2018
This is version 180 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health