P17852 (ITA3_CRIGR) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Integrin alpha-3 Alternative name(s): CD49 antigen-like family member C Galactoprotein B3 Short name=GAPB3 VLA-3 subunit alpha CD_antigen=CD49c Cleaved into the following 2 chains: | ||
| Gene names |
| ||
| Organism | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) | ||
| Taxonomic identifier | 10029 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Cricetidae › Cricetinae › Cricetulus![]() |
Protein attributes
| Sequence length | 1051 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration By similarity. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5 By similarity. |
| Subcellular location | |
| Post-translational modification | Isoform 1, but not isoform 2, is phosphorylated on serine residues. |
| Sequence similarities | Belongs to the integrin alpha chain family. Contains 7 FG-GAP repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| Ligand | Calcium Metal-binding |
| Molecular function | Integrin Receptor |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW integrin-mediated signaling pathwayInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integrin complex Inferred from electronic annotation. Source: InterPro |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P17852-1) Also known as: Alpha-3A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P17852-2) Also known as: Alpha-3B; The sequence of this isoform differs from the canonical sequence as follows: 1021-1051: RARTRALYEAKRQKAEMKSQPSETERLTDDY → PTRYYRIMPK...TSWQIRDRYY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | |||||||||
| Chain | 33 – 1051 | 1019 | Integrin alpha-3 | PRO_0000016235 | |||||||
| Chain | 33 – 872 | 840 | Integrin alpha-3 heavy chain Potential | PRO_0000016236 | |||||||
| Chain | 876 – 1051 | 176 | Integrin alpha-3 light chain Potential | PRO_0000016237 | |||||||
Regions | |||||||||||
| Topological domain | 33 – 991 | 959 | Extracellular Potential | ||||||||
| Transmembrane | 992 – 1019 | 28 | Helical; Potential | ||||||||
| Topological domain | 1020 – 1051 | 32 | Cytoplasmic Potential | ||||||||
| Repeat | 38 – 103 | 66 | FG-GAP 1 | ||||||||
| Repeat | 110 – 171 | 62 | FG-GAP 2 | ||||||||
| Repeat | 185 – 236 | 52 | FG-GAP 3 | ||||||||
| Repeat | 237 – 293 | 57 | FG-GAP 4 | ||||||||
| Repeat | 294 – 354 | 61 | FG-GAP 5 | ||||||||
| Repeat | 356 – 411 | 56 | FG-GAP 6 | ||||||||
| Repeat | 415 – 477 | 63 | FG-GAP 7 | ||||||||
| Calcium binding | 315 – 323 | 9 | Potential | ||||||||
| Calcium binding | 378 – 386 | 9 | Potential | ||||||||
| Calcium binding | 439 – 447 | 9 | Potential | ||||||||
| Motif | 1017 – 1021 | 5 | GFFKR motif | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 500 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 511 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 573 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 605 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 656 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 697 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 841 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 923 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 926 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 935 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 969 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 94 ↔ 103 | By similarity | |||||||||
| Disulfide bond | 140 ↔ 162 | By similarity | |||||||||
| Disulfide bond | 185 ↔ 197 | By similarity | |||||||||
| Disulfide bond | 485 ↔ 490 | By similarity | |||||||||
| Disulfide bond | 496 ↔ 550 | By similarity | |||||||||
| Disulfide bond | 615 ↔ 621 | By similarity | |||||||||
| Disulfide bond | 694 ↔ 702 | By similarity | |||||||||
| Disulfide bond | 846 ↔ 904 | Interchain (between heavy and light chains) By similarity | |||||||||
| Disulfide bond | 911 ↔ 916 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1021 – 1051 | 31 | RARTR…LTDDY → PTRYYRIMPKYHAVRIREEE RYPPPGSTLPTKKHWVTSWQ IRDRYY in isoform 2. | VSP_002720 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Characterization through cDNA cloning of galactoprotein b3 (Gap b3), a cell surface membrane glycoprotein showing enhanced expression on oncogenic transformation. Identification of Gap b3 as a member of the integrin superfamily." Tsuji T., Yamamoto F., Miura Y., Takio K., Titani K., Pawar S., Osawa T., Hakomori S. J. Biol. Chem. 265:7016-7021(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Fibroblast. |
| [2] | "Cell type-specific integrin variants with alternative alpha chain cytoplasmic domains." Tamura R.N., Cooper H.M., Collo G., Quaranta V. Proc. Natl. Acad. Sci. U.S.A. 88:10183-10187(1991) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | J05281 mRNA. Translation: AAA56794.1. |
| PIR | A35761. |
3D structure databases | |
| ProteinModelPortal | P17852. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG108011. |
Family and domain databases | |
| InterPro | IPR013519. Int_alpha_beta-p. IPR000413. Integrin_alpha. IPR013649. Integrin_alpha-2. IPR018184. Integrin_alpha_C_CS. [Graphical view] |
| Pfam | PF08441. Integrin_alpha2. 1 hit. [Graphical view] |
| PRINTS | PR01185. INTEGRINA. |
| SMART | SM00191. Int_alpha. 5 hits. [Graphical view] |
| PROSITE | PS51470. FG_GAP. 7 hits. PS00242. INTEGRIN_ALPHA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | ITA3_CRIGR | ||||||||
| Accession | Primary (citable) accession number: P17852 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
