P17813 (EGLN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 148.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Endoglin Alternative name(s): CD_antigen=CD105 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 658 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. |
| Subunit structure | Homodimer that forms a heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It is able to bind TGF-beta 1, and 3 efficiently and TGF-beta 2 less efficiently. Interacts with TCTEX1D4. Interacts with ARRB2. Ref.6 Ref.7 |
| Subcellular location | |
| Tissue specificity | Endoglin is restricted to endothelial cells in all tissues except bone marrow. |
| Involvement in disease | Hereditary hemorrhagic telangiectasia 1 (HHT1) [MIM:187300]: Autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TGFB1 | P01137 | 2 | EBI-2834630,EBI-779636 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P17813-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P17813-2) The sequence of this isoform differs from the canonical sequence as follows: 619-658: SPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA → EYPRPPQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Ref.4 | ||||||
| Chain | 26 – 658 | 633 | Endoglin | PRO_0000021156 | |||||
Regions | |||||||||
| Topological domain | 26 – 586 | 561 | Extracellular Potential | ||||||
| Transmembrane | 587 – 611 | 25 | Helical; Potential | ||||||
| Topological domain | 612 – 658 | 47 | Cytoplasmic Potential | ||||||
| Motif | 399 – 401 | 3 | Cell attachment site Potential | ||||||
| Compositional bias | 336 – 576 | 241 | Ser/Thr-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 646 | 1 | Phosphoserine; by TGFBR1 By similarity | ||||||
| Modified residue | 649 | 1 | Phosphoserine; by TGFBR1 By similarity | ||||||
| Glycosylation | 88 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 121 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 134 | 1 | N-linked (GlcNAc...) Ref.8 | ||||||
| Glycosylation | 307 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 619 – 658 | 40 | SPSKR…TSSMA → EYPRPPQ in isoform Short. | VSP_004233 | |||||
| Natural variant | 5 | 1 | T → M. Ref.9 Corresponds to variant rs35400405 [ dbSNP | Ensembl ]. | VAR_005192 | |||||
| Natural variant | 8 | 1 | L → P in HHT1. Ref.15 | VAR_026774 | |||||
| Natural variant | 49 | 1 | V → F in HHT1. Ref.15 | VAR_026775 | |||||
| Natural variant | 52 | 1 | G → V in HHT1. Ref.11 Ref.12 | VAR_005193 | |||||
| Natural variant | 53 | 1 | C → R in HHT1. Ref.11 Ref.12 Ref.14 | VAR_005194 | |||||
| Natural variant | 107 | 1 | L → R in HHT1. Ref.15 | VAR_026776 | |||||
| Natural variant | 149 | 1 | W → C in HHT1. Ref.11 Ref.12 | VAR_005195 | |||||
| Natural variant | 160 | 1 | A → D in HHT1. Ref.10 | VAR_009120 | |||||
| Natural variant | 192 – 198 | 7 | Missing in HHT1. | VAR_005196 | |||||
| Natural variant | 207 | 1 | Missing in HHT1. Ref.15 | VAR_026777 | |||||
| Natural variant | 221 | 1 | L → P in HHT1. Ref.12 Ref.16 | VAR_009121 | |||||
| Natural variant | 232 – 233 | 2 | Missing in HHT1. | VAR_026778 | |||||
| Natural variant | 263 | 1 | I → T in HHT1. Ref.15 | VAR_026780 | |||||
| Natural variant | 263 | 1 | Missing in HHT1. Ref.15 Ref.16 | VAR_026779 | |||||
| Natural variant | 306 | 1 | L → P in HHT1. Ref.11 | VAR_005197 | |||||
| Natural variant | 366 | 1 | D → H. Corresponds to variant rs1800956 [ dbSNP | Ensembl ]. | VAR_014764 | |||||
| Natural variant | 412 | 1 | C → S in HHT1. Ref.15 | VAR_026781 | |||||
| Natural variant | 413 | 1 | G → V in HHT1. Ref.13 | VAR_037140 | |||||
| Natural variant | 504 | 1 | V → M in HHT1. Ref.15 | VAR_026782 | |||||
| Natural variant | 615 | 1 | S → L in HHT1. Ref.16 | VAR_026783 | |||||
Experimental info | |||||||||
| Sequence conflict | 14 | 1 | L → G AA sequence Ref.4 | ||||||
| Sequence conflict | 122 – 130 | 9 | SSLVTFQEP → FQPGHLPRA Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and expression of two forms of the human transforming growth factor-beta-binding protein endoglin with distinct cytoplasmic regions." Bellon T., Corbi A., Lastres P., Cales C., Cebrian M., Vera S., Cheifetz S., Massague J., Letarte M., Bernabeu C. Eur. J. Immunol. 23:2340-2345(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). |
| [2] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Primary structure of endoglin, an RGD-containing glycoprotein of human endothelial cells." Gougos A., Letarte M. J. Biol. Chem. 265:8361-8364(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 14-658, PROTEIN SEQUENCE OF 26-36 (ISOFORM LONG). Tissue: Umbilical vein. |
| [5] | "Endoglin, a TGF-beta binding protein of endothelial cells, is the gene for hereditary haemorrhagic telangiectasia type 1." McAllister K.A., Grogg K.M., Johnson D.W., Gallione C.J., Baldwin M.A., Jackson C.E., Helmbold E.A., Markel D.S., McKinnon W.C., Murrell J., McCormick M.K., Pericak-Vance M.A., Heutink P., Oostra B.A., Haitjema T., Westerman C.J., Porteous M.E., Guttmacher A.E., Letarte M., Marchuk D.A. Nat. Genet. 8:345-351(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 122-378. |
| [6] | "Identification of Tctex2beta, a novel dynein light chain family member that interacts with different transforming growth factor-beta receptors." Meng Q.-J., Lux A., Holloschi A., Li J., Hughes J.M.X., Foerg T., McCarthy J.E.G., Heagerty A.M., Kioschis P., Hafner M., Garland J.M. J. Biol. Chem. 281:37069-37080(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TCTEX1D4. |
| [7] | "The interaction of endoglin with beta-arrestin2 regulates transforming growth factor-beta-mediated ERK activation and migration in endothelial cells." Lee N.Y., Blobe G.C. J. Biol. Chem. 282:21507-21517(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARRB2. |
| [8] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-134, MASS SPECTROMETRY. Tissue: Liver. |
| [9] | "Characterization of endoglin and identification of novel mutations in hereditary hemorrhagic telangiectasia." Shovlin C.L., Hughes J.M.B., Scott J., Seidman C.E., Seidman J.G. Am. J. Hum. Genet. 61:68-79(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HHT1 192-ARG--PRO-198 DEL, VARIANT MET-5. |
| [10] | "A novel missense mutation in the endoglin gene in hereditary hemorrhagic telangiectasia." Yamaguchi H., Azuma H., Shigekiyo T., Inoue H., Saito S. Thromb. Haemost. 77:243-247(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HHT1 ASP-160. |
| [11] | "Mutation and expression analysis of the endoglin gene in hereditary hemorrhagic telangiectasia reveals null alleles." Gallione C.J., Klaus D.J., Yeh E.Y., Stenzel T.T., Xue Y., Anthony K.B., McAllister K.A., Baldwin M.A., Berg J.N., Lux A., Smith J.D., Vary C.P.H., Craigen W.J., Westermann C.J.J., Warner M.L., Miller Y.E., Jackson C.E., Guttmacher A.E., Marchuk D.A. Hum. Mutat. 11:286-294(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HHT1 VAL-52; ARG-53; CYS-149 AND PRO-306. |
| [12] | "Expression analysis of four endoglin missense mutations suggests that haploinsufficiency is the predominant mechanism for hereditary hemorrhagic telangiectasia type 1." Pece-Barbara N., Cymerman U., Vera S., Marchuk D.A., Letarte M. Hum. Mol. Genet. 8:2171-2181(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HHT1 VAL-52; ARG-53; CYS-149 AND PRO-221. |
| [13] | "Two common endoglin mutations in families with hereditary hemorrhagic telangiectasia in the Netherlands Antilles: evidence for a founder effect." Gallione C.J., Scheessele E.A., Reinhardt D., Duits A.J., Berg J.N., Westermann C.J.J., Marchuk D.A. Hum. Genet. 107:40-44(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HHT1 VAL-413. |
| [14] | "Identification of hereditary hemorrhagic telangiectasia type 1 in newborns by protein expression and mutation analysis of endoglin." Cymerman U., Vera S., Pece-Barbara N., Bourdeau A., White R.I. Jr., Dunn J., Letarte M. Pediatr. Res. 47:24-35(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HHT1 ARG-53. |
| [15] | "Molecular screening of ALK1/ACVRL1 and ENG genes in hereditary hemorrhagic telangiectasia in France." French Rendu-Osler network Lesca G., Plauchu H., Coulet F., Lefebvre S., Plessis G., Odent S., Riviere S., Leheup B., Goizet C., Carette M.-F., Cordier J.-F., Pinson S., Soubrier F., Calender A., Giraud S. Hum. Mutat. 23:289-299(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HHT1 PRO-8; PHE-49; ARG-107; CYS-207 DEL; THR-263; ARG-232-233-THR DEL; ILE-263 DEL; SER-412 AND MET-504. |
| [16] | "Hepatic manifestation is associated with ALK1 in hereditary hemorrhagic telangiectasia: identification of five novel ALK1 and one novel ENG mutations." Kuehl H.K.A., Caselitz M., Hasenkamp S., Wagner S., El-Harith E.-H.A., Manns M.P., Stuhrmann M. Hum. Mutat. 25:320-320(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HHT1 PRO-221; ILE-263 DEL AND LEU-615. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X72012 mRNA. Translation: CAA50891.1. AL157935, AL162586 Genomic DNA. Translation: CAI12604.1. AL162586, AL157935 Genomic DNA. Translation: CAI39764.1. CH471090 Genomic DNA. Translation: EAW87702.1. J05481 mRNA. Translation: AAA35800.1. U37439 U37441 Genomic DNA. Translation: AAC63386.1. |
| IPI | IPI00017567. IPI00219625. |
| PIR | S50831. |
| RefSeq | NP_000109.1. NM_000118.2. NP_001108225.1. NM_001114753.1. |
| UniGene | Hs.76753. |
3D structure databases | |
| ProteinModelPortal | P17813. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-6246N. |
| IntAct | P17813. 4 interactions. |
| STRING | 9606.ENSP00000362299. |
PTM databases | |
| PhosphoSite | P17813. |
Polymorphism databases | |
| DMDM | 3041681. |
Proteomic databases | |
| PaxDb | P17813. |
| PRIDE | P17813. |
Protocols and materials databases | |
| DNASU | 2022. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000344849; ENSP00000341917; ENSG00000106991. ENST00000373203; ENSP00000362299; ENSG00000106991. ENST00000545345; ENSP00000441025; ENSG00000106991. |
| GeneID | 2022. |
| KEGG | hsa:2022. |
| UCSC | uc004bsj.4. human. |
Organism-specific databases | |
| CTD | 2022. |
| GeneCards | GC09M130577. |
| HGNC | HGNC:3349. ENG. |
| HPA | CAB000096. HPA011862. |
| MIM | 131195. gene. 187300. phenotype. |
| neXtProt | NX_P17813. |
| Orphanet | 2929. Juvenile gastrointestinal polyposis. 774. Rendu-Osler-Weber disease. |
| PharmGKB | PA27785. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG46276. |
| HOGENOM | HOG000112346. |
| HOVERGEN | HBG005573. |
| InParanoid | P17813. |
| KO | K06526. |
| OMA | SWLIDAN. |
| OrthoDB | EOG4WWRJG. |
| PhylomeDB | P17813. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | hif1_tfpathway. HIF-1-alpha transcription factor network. |
Gene expression databases | |
| ArrayExpress | P17813. |
| Bgee | P17813. |
| CleanEx | HS_ENG. |
| Genevestigator | P17813. |
| GermOnline | ENSG00000106991. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001507. ZP_dom. [Graphical view] |
| Pfam | PF00100. Zona_pellucida. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ENG. human. |
| GenomeRNAi | 2022. |
| NextBio | 8193. |
| SOURCE | Search... |
Entry information
| Entry name | EGLN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P17813 Secondary accession number(s): Q14248, Q14926, Q5T9C0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
