P17706 (PTN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 142.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase non-receptor type 2 EC=3.1.3.48 Alternative name(s): T-cell protein-tyrosine phosphatase Short name=TCPTP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 415 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with RMDN3. Isoform PTPB interacts with TMED9. Ref.9 Ref.10 |
| Subcellular location | Isoform PTPB: Endoplasmic reticulum Ref.8. |
| Tissue specificity | Isoform PTPA is probably the major isoform. Isoform PTPB is expressed in T-cells and in placenta. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Endoplasmic reticulum Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | insulin receptor signaling pathway Inferred from electronic annotation. Source: Compara interferon-gamma-mediated signaling pathwayTraceable author statement. Source: Reactome regulation of interferon-gamma-mediated signaling pathwayTraceable author statement. Source: Reactome |
| Cellular_component | endoplasmic reticulum Inferred from direct assay PubMed 10940933. Source: UniProtKB nucleoplasmTraceable author statement. Source: Reactome |
| Molecular_function | non-membrane spanning protein tyrosine phosphatase activity Inferred from electronic annotation. Source: Compara protein tyrosine phosphatase activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GHR | P10912 | 8 | EBI-984930,EBI-286316 | |
| TMED10 | P49755 | 5 | EBI-4409481,EBI-998422 | |
| TMED9 | Q9BVK6 | 5 | EBI-4409481,EBI-1056827 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PTPB (identifier: P17706-1) Also known as: p48TC; TC48; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PTPA (identifier: P17706-2) Also known as: p45TC; TC45; The sequence of this isoform differs from the canonical sequence as follows: 382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT | ||||||
| Isoform 3 (identifier: P17706-3) The sequence of this isoform differs from the canonical sequence as follows: 347-380: Missing. 382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 415 | 415 | Tyrosine-protein phosphatase non-receptor type 2 | PRO_0000094752 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 5 – 275 | 271 | Tyrosine-protein phosphatase | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 216 – 222 | 7 | Substrate binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 216 | 1 | Phosphocysteine intermediate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 182 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 260 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 304 | 1 | Phosphoserine Ref.11 Ref.12 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 347 – 380 | 34 | Missing in isoform 3. | VSP_043383 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 382 – 415 | 34 | WLYWQ…QQNAL → PRLTDT in isoform PTPA and isoform 3. | VSP_005125 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 407 | 1 | T → R in AAA65997. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 407 | 1 | T → R in M81478. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 7 – 14 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 19 – 28 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 38 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 40 – 45 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 55 – 57 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 58 – 60 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 68 – 76 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 79 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 87 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 93 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 103 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 108 – 111 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 132 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 136 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 137 – 140 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 150 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 163 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 164 – 166 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 177 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 182 – 184 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 201 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 202 – 205 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 212 – 221 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 235 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 239 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 244 – 251 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 252 – 254 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 275 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA isolated from a human T-cell library encodes a member of the protein-tyrosine-phosphatase family." Cool D., Tonks N.K., Charbonneau H., Walsh K.A., Fischer E.H., Krebs E.G. Proc. Natl. Acad. Sci. U.S.A. 86:5257-5261(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: T-cell. |
| [2] | "Cloning and characterization of a mouse cDNA encoding a cytoplasmic protein-tyrosine-phosphatase." Mosinger B. Jr., Tillmann U., Westphal H., Tremblay M.L. Proc. Natl. Acad. Sci. U.S.A. 89:499-503(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Testis. |
| [5] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS PTPB AND 3). Tissue: Brain and Eye. |
| [8] | "COOH-terminal sequence motifs target the T cell protein tyrosine phosphatase to the ER and nucleus." Lorenzen J.A., Dadabay C.Y., Fischer E.H. J. Cell Biol. 131:631-643(1995) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION (ISOFORMS PTPA AND PTPB). |
| [9] | "The novel protein PTPIP51 exhibits tissue- and cell-specific expression." Stenzinger A., Kajosch T., Tag C., Porsche A., Welte I., Hofer H.W., Steger K., Wimmer M. Histochem. Cell Biol. 123:19-28(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RMDN3. |
| [10] | "Evidence for a role of transmembrane protein p25 in localization of protein tyrosine phosphatase TC48 to the ER." Gupta V., Swarup G. J. Cell Sci. 119:1703-1714(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TMED9. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298 AND SER-304, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-304, MASS SPECTROMETRY. |
| [15] | "Structure determination of T cell protein-tyrosine phosphatase." Iversen L.F., Moller K.B., Pedersen A.K., Peters G.H., Petersen A.S., Andersen H.S., Branner S., Mortensen S.B., Moller N.P. J. Biol. Chem. 277:19982-19990(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.56 ANGSTROMS) OF 1-314. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M25393 mRNA. Translation: AAA65997.1. M81478 mRNA. No translation available. EF445017 Genomic DNA. Translation: ACA06062.1. EF445017 Genomic DNA. Translation: ACA06064.1. AK292570 mRNA. Translation: BAF85259.1. AP001077 Genomic DNA. No translation available. AP002449 Genomic DNA. No translation available. AP005482 Genomic DNA. No translation available. CH471113 Genomic DNA. Translation: EAX01532.1. CH471113 Genomic DNA. Translation: EAX01539.1. BC008244 mRNA. Translation: AAH08244.1. BC016727 mRNA. Translation: AAH16727.1. | ||||||||||||
| IPI | IPI00106928. IPI00218788. IPI00219695. | ||||||||||||
| PIR | A33899. | ||||||||||||
| RefSeq | NP_002819.2. NM_002828.3. NP_536347.1. NM_080422.2. NP_536348.1. NM_080423.2. | ||||||||||||
| UniGene | Hs.654527. Hs.663373. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P17706. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P17706. 10 interactions. | ||||||||||||
| MINT | MINT-3975566. | ||||||||||||
| STRING | 9606.ENSP00000311857. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P17706. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 229462762. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P17706. | ||||||||||||
| PRIDE | P17706. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 5771. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000309660; ENSP00000311857; ENSG00000175354. ENST00000327283; ENSP00000320298; ENSG00000175354. ENST00000353319; ENSP00000320546; ENSG00000175354. | ||||||||||||
| GeneID | 5771. | ||||||||||||
| KEGG | hsa:5771. | ||||||||||||
| UCSC | uc002krp.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5771. | ||||||||||||
| GeneCards | GC18M012775. | ||||||||||||
| HGNC | HGNC:9650. PTPN2. | ||||||||||||
| HPA | HPA015004. HPA046176. | ||||||||||||
| MIM | 176887. gene. | ||||||||||||
| neXtProt | NX_P17706. | ||||||||||||
| PharmGKB | PA33993. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5599. | ||||||||||||
| HOGENOM | HOG000273908. | ||||||||||||
| HOVERGEN | HBG008321. | ||||||||||||
| InParanoid | P17706. | ||||||||||||
| KO | K01104. | ||||||||||||
| OMA | NTAQKVQ. | ||||||||||||
| PhylomeDB | P17706. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | ifngpathway. IFN-gamma pathway. pdgfrbpathway. PDGFR-beta signaling pathway. | ||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P17706. | ||||||||||||
| Bgee | P17706. | ||||||||||||
| CleanEx | HS_PTPN2. | ||||||||||||
| Genevestigator | P17706. | ||||||||||||
| GermOnline | ENSG00000175354. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR012265. Ptpn1/2. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] | ||||||||||||
| PANTHER | PTHR19134:SF57. PTHR19134:SF57. 1 hit. | ||||||||||||
| Pfam | PF00102. Y_phosphatase. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF000926. Tyr-Ptase_nr1. 1 hit. | ||||||||||||
| PRINTS | PR00700. PRTYPHPHTASE. | ||||||||||||
| SMART | SM00194. PTPc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P17706. | ||||||||||||
| ChEMBL | CHEMBL3807. | ||||||||||||
| ChiTaRS | PTPN2. human. | ||||||||||||
| EvolutionaryTrace | P17706. | ||||||||||||
| GenomeRNAi | 5771. | ||||||||||||
| NextBio | 22446. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PTN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P17706 Secondary accession number(s): A8K955 Q96HR2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
