Reviewed,
UniProtKB/Swiss-Prot P17706 (PTN2_HUMAN)
Last modified
June 16, 2009.
Version 105.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase non-receptor type 2 EC=3.1.3.48 Alternative name(s): T-cell protein-tyrosine phosphatase Short name=TCPTP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 415 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with FAM82A2. Ref.7 |
| Subcellular location | |
| Tissue specificity | PTPA isoform is probably the major PTP expressed in human tissues. PTPB isoform was found in T-cells and in placenta. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | protein amino acid dephosphorylation Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct protein tyrosine phosphatase activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GHR | P10912 | 2 | EBI-984930,EBI-286316 | |
| WASL | O00401 | 1 | EBI-984930,EBI-957615 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PTPB (identifier: P17706-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PTPA (identifier: P17706-2) The sequence of this isoform differs from the canonical sequence as follows: 382-415: WLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL → PRLTDT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 415 | 415 | Tyrosine-protein phosphatase non-receptor type 2 | PRO_0000094752 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 5 – 275 | 271 | Tyrosine-protein phosphatase | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 216 | 1 | Phosphocysteine intermediate By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 304 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 382 – 415 | 34 | WLYWQ…QQNAL → PRLTDT in isoform PTPA. | VSP_005125 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 407 | 1 | T → R in AAA65997. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 407 | 1 | T → R in M81478. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 7 – 14 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 19 – 28 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 35 – 38 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 40 – 45 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 55 – 57 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 58 – 60 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 68 – 76 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 79 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 87 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 91 – 93 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 103 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 108 – 111 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 132 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 136 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 137 – 140 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 150 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 163 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 164 – 166 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 177 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 182 – 184 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 201 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 202 – 205 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 212 – 221 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 235 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 239 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 244 – 251 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 252 – 254 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 275 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA isolated from a human T-cell library encodes a member of the protein-tyrosine-phosphatase family." Cool D., Tonks N.K., Charbonneau H., Walsh K.A., Fischer E.H., Krebs E.G. Proc. Natl. Acad. Sci. U.S.A. 86:5257-5261(1989) [PubMed: 2546150] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: T-cell. |
| [2] | "Cloning and characterization of a mouse cDNA encoding a cytoplasmic protein-tyrosine-phosphatase." Mosinger B. Jr., Tillmann U., Westphal H., Tremblay M.L. Proc. Natl. Acad. Sci. U.S.A. 89:499-503(1992) [PubMed: 1731319] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Testis. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PTPB). Tissue: Eye. |
| [7] | "The novel protein PTPIP51 exhibits tissue- and cell-specific expression." Stenzinger A., Kajosch T., Tag C., Porsche A., Welte I., Hofer H.W., Steger K., Wimmer M. Histochem. Cell Biol. 123:19-28(2005) [PubMed: 15609043] [Abstract] Cited for: INTERACTION WITH FAM82A2. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-298 AND SER-304, MASS SPECTROMETRY. |
| [9] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [10] | "Structure determination of T cell protein-tyrosine phosphatase." Iversen L.F., Moller K.B., Pedersen A.K., Peters G.H., Petersen A.S., Andersen H.S., Branner S., Mortensen S.B., Moller N.P. J. Biol. Chem. 277:19982-19990(2002) [PubMed: 11907034] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.56 ANGSTROMS) OF 1-314. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M25393 mRNA. Translation: AAA65997.1. M81478 mRNA. No translation available. EF445017 Genomic DNA. Translation: ACA06062.1. AK292570 mRNA. Translation: BAF85259.1. CH471113 Genomic DNA. Translation: EAX01532.1. BC008244 mRNA. Translation: AAH08244.1. | |||||||||||||
| IPI | IPI00218788. IPI00219695. | ||||||||||||
| PIR | A33899. | ||||||||||||
| RefSeq | NP_002819.1. NP_536347.1. | ||||||||||||
| UniGene | Hs.654527 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P17706. 3 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P17706. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000175354. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 5771. | ||||||||||||
| KEGG | hsa:5771. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC18M012775. | ||||||||||||
| H-InvDB | HIX0014345. | ||||||||||||
| HGNC | HGNC:9650. PTPN2. | ||||||||||||
| MIM | 176887. gene. | ||||||||||||
| PharmGKB | PA33993. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | P17706. | ||||||||||||
| HOVERGEN | P17706. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.3.48. 247. | ||||||||||||
| Pathway_Interaction_DB | ifngpathway. IFN-gamma pathway. pdgfrbpathway. PDGFR-beta signaling pathway. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P17706. | ||||||||||||
| Bgee | P17706. | ||||||||||||
| CleanEx | HS_PTPN2. | ||||||||||||
| GermOnline | ENSG00000175354. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000387. Tyr_Pase. IPR016130. Tyr_Pase_AS. IPR012265. Tyr_Pase_non-rcpt_typ-1/2. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] | ||||||||||||
| PANTHER | PTHR19134:SF57. Tyr_Phos_no_rcpt. 1 hit. | ||||||||||||
| Pfam | PF00102. Y_phosphatase. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF000926. Tyr-Ptase_nr1. 1 hit. | ||||||||||||
| PRINTS | PR00700. PRTYPHPHTASE. | ||||||||||||
| SMART | SM00194. PTPc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| BindingDB | P17706. | ||||||||||||
| NextBio | 22446. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PTN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P17706 Secondary accession number(s): A8K955, Q96HR2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


