P17677 (NEUM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuromodulin Alternative name(s): Axonal membrane protein GAP-43 Growth-associated protein 43 Neural phosphoprotein B-50 pp46 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 238 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction. Ref.8 |
| Subunit structure | Identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, GAP43 and CTTN By similarity. Binds calmodulin with a greater affinity in the absence of Ca2+ than in its presence By similarity. |
| Subcellular location | Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection › growth cone membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction › synapse. Cell projection › filopodium membrane; Peripheral membrane protein. Note: Cytoplasmic surface of growth cone and synaptic plasma membranes. Ref.8 |
| Post-translational modification | Phosphorylated at Ser-41 by PHK. Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity. Palmitoylation by ARF6 is essential for plasma membrane association and axonal and dendritic filopodia induction. |
| Sequence similarities | Belongs to the neuromodulin family. Contains 1 IQ domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PRKCD | Q05655 | 4 | EBI-1267511,EBI-704279 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P17677-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P17677-2) The sequence of this isoform differs from the canonical sequence as follows: 1-10: MLCCMRRTKQ → MTKSCSELCHPALHFLPCLGGLRKNLQRAVRPSPYSLGFLTFWISR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 238 | 238 | Neuromodulin | PRO_0000159596 | |||||
Regions | |||||||||
| Domain | 31 – 60 | 30 | IQ | ||||||
| Region | 1 – 4 | 4 | Important for membrane binding | ||||||
Amino acid modifications | |||||||||
| Modified residue | 41 | 1 | Phosphoserine; by PHK and PKC By similarity | ||||||
| Modified residue | 94 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 181 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 202 | 1 | Phosphoserine; by CK2 By similarity | ||||||
| Modified residue | 203 | 1 | Phosphoserine; by CK2 By similarity | ||||||
| Lipidation | 3 | 1 | S-palmitoyl cysteine By similarity | ||||||
| Lipidation | 4 | 1 | S-palmitoyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 10 | 10 | MLCCMRRTKQ → MTKSCSELCHPALHFLPCLG GLRKNLQRAVRPSPYSLGFL TFWISR in isoform 2. | VSP_042783 | |||||
| Natural variant | 59 | 1 | V → I. Ref.9 Corresponds to variant rs6291 [ dbSNP | Ensembl ]. | VAR_014172 | |||||
| Natural variant | 162 | 1 | K → E. Corresponds to variant rs11557762 [ dbSNP | Ensembl ]. | VAR_050271 | |||||
Experimental info | |||||||||
| Mutagenesis | 3 – 4 | 2 | CC → SS: Inhibits axonal and dendritic filopodia formation and reduces dendritic and axonal branching. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human GAP-43: its deduced amino acid sequence and chromosomal localization in mouse and human." Kosik K.S., Orecchio L.D., Bruns G.A.P., Benowitz L.I., McDonald G.P., Cox D.R., Neve R. Neuron 1:127-132(1988) [PubMed: 3272162] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning of human GAP-43: growth association and ischemic resurgence." Ng S.-C., de la Monte S.M., Conboy G.L., Karns L.R., Fishman M.C. Neuron 1:133-139(1988) [PubMed: 3272163] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Structure of the human gene for the neural phosphoprotein B-50 (GAP-43)." Nielander H.B., de Groen P.C., Eggen B.J., Schrama L.H., Gispen W.H., Schotman P. Brain Res. Mol. Brain Res. 19:293-302(1993) [PubMed: 8231732] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | NIEHS SNPs program Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain cortex and Subthalamic nucleus. |
| [6] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [8] | "Regulation of dendritic branching and filopodia formation in hippocampal neurons by specific acylated protein motifs." Gauthier-Campbell C., Bredt D.S., Murphy T.H., El-Husseini A. Mol. Biol. Cell 15:2205-2217(2004) [PubMed: 14978216] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 3-CYS-CYS-4. |
| [9] | "Characterization of single-nucleotide polymorphisms in coding regions of human genes." Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 22:231-238(1999) [PubMed: 10391209] [Abstract] Cited for: VARIANT ILE-59. |
| [10] | Erratum Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S. Nat. Genet. 23:373-373(1999) |
| + | Additional computationally mapped references. |
Web resources
| NIEHS-SNPs |
| Wikipedia Gap-43 entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M25667 mRNA. Translation: AAA52516.1. S66541, S66533, S66534 Genomic DNA. Translation: AAB28649.1. AY842481 Genomic DNA. Translation: AAV88094.1. AK289699 mRNA. Translation: BAF82388.1. AK290100 mRNA. Translation: BAF82789.1. AC012598 Genomic DNA. No translation available. AC092468 Genomic DNA. No translation available. AC119795 Genomic DNA. No translation available. BC007936 mRNA. Translation: AAH07936.1. |
| IPI | IPI00015964. IPI00791316. |
| PIR | I52638. |
| RefSeq | NP_001123536.1. NM_001130064.1. NP_002036.1. NM_002045.3. |
| UniGene | Hs.134974. |
3D structure databases | |
| ProteinModelPortal | P17677. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-452N. |
| IntAct | P17677. 1 interaction. |
| STRING | P17677. |
Protein family/group databases | |
| TCDB | 1.A.71.2.1. brain acid-soluble protein channel (BASP1 Channel) family. |
PTM databases | |
| PhosphoSite | P17677. |
Polymorphism databases | |
| DMDM | 128100. |
Proteomic databases | |
| PRIDE | P17677. |
Protocols and materials databases | |
| DNASU | 2596. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000305124; ENSP00000305010; ENSG00000172020. ENST00000393780; ENSP00000377372; ENSG00000172020. |
| GeneID | 2596. |
| KEGG | hsa:2596. |
| UCSC | uc003ebq.2. human. |
Organism-specific databases | |
| CTD | 2596. |
| GeneCards | GC03P115342. |
| H-InvDB | HIX0003572. |
| HGNC | HGNC:4140. GAP43. |
| HPA | CAB004417. HPA013392. HPA015600. |
| MIM | 162060. gene. |
| neXtProt | NX_P17677. |
| PharmGKB | PA28553. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG120480. |
| GeneTree | ENSGT00530000063966. |
| HOGENOM | HOG000013014. |
| HOVERGEN | HBG006468. |
Gene expression databases | |
| ArrayExpress | P17677. |
| Bgee | P17677. |
| CleanEx | HS_GAP43. |
| Genevestigator | P17677. |
| GermOnline | ENSG00000172020. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000048. IQ_motif_EF-hand-BS. IPR001422. Neuromodulin. IPR017454. Neuromodulin_C. IPR018947. Neuromodulin_gap-junction_N. IPR018243. Neuromodulin_palmitoyl/P_site. [Graphical view] |
| Pfam | PF00612. IQ. 1 hit. PF06614. Neuromodulin. 1 hit. PF10580. Neuromodulin_N. 1 hit. [Graphical view] |
| PRINTS | PR00215. NEUROMODULIN. |
| SMART | SM00015. IQ. 1 hit. [Graphical view] |
| PROSITE | PS50096. IQ. 1 hit. PS00412. NEUROMODULIN_1. 1 hit. PS00413. NEUROMODULIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 10267. |
| SOURCE | Search... |
Entry information
| Entry name | NEUM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P17677 Secondary accession number(s): A8K0Y4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with