Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 17

Gene

ZNF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri190 – 21223C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri218 – 24023C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri246 – 26823C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri274 – 29623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri302 – 32423C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri358 – 38023C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri386 – 40823C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri414 – 43623C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri442 – 46423C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri470 – 49223C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri498 – 52023C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri526 – 54823C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri554 – 57623C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri582 – 60423C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri610 – 63223C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri638 – 66023C2H2-type 17PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 17
Alternative name(s):
Zinc finger protein HPF3
Zinc finger protein KOX10
Gene namesi
Name:ZNF17
Synonyms:KIAA1947, KOX10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:12958. ZNF17.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37540.

Polymorphism and mutation databases

BioMutaiZNF17.
DMDMi229485310.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 662662Zinc finger protein 17PRO_0000047339Add
BLAST

Proteomic databases

MaxQBiP17021.
PaxDbiP17021.
PeptideAtlasiP17021.
PRIDEiP17021.

PTM databases

iPTMnetiP17021.
PhosphoSiteiP17021.

Expressioni

Gene expression databases

BgeeiP17021.
CleanExiHS_ZNF17.
ExpressionAtlasiP17021. baseline and differential.

Interactioni

Protein-protein interaction databases

BioGridi113396. 2 interactions.
IntActiP17021. 1 interaction.
STRINGi9606.ENSP00000471905.

Structurei

3D structure databases

ProteinModelPortaliP17021.
SMRiP17021. Positions 82-662.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini8 – 10194KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 17 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri190 – 21223C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri218 – 24023C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri246 – 26823C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri274 – 29623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri302 – 32423C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri358 – 38023C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri386 – 40823C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri414 – 43623C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri442 – 46423C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri470 – 49223C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri498 – 52023C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri526 – 54823C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri554 – 57623C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri582 – 60423C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri610 – 63223C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri638 – 66023C2H2-type 17PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119107.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiP17021.
KOiK09228.
OMAiFFRHNSN.
OrthoDBiEOG7KSX7Q.
PhylomeDBiP17021.
TreeFamiTF339848.

Family and domain databases

Gene3Di3.30.160.60. 17 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 3 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 18 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 18 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P17021-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNLTEDYMVF EDVAIHFSQE EWGILNDVQR HLHSDVMLEN FALLSSVGCW
60 70 80 90 100
HGAKDEEAPS KQCVSVGVSQ VTTLKPALST QKAQPCETCS SLLKDILHLA
110 120 130 140 150
EHDGTHPKRT AKLYLHQKEH LREKLTRSDE GRPSFVNDSV HLAKRNLTCM
160 170 180 190 200
QGGKDFTGDS DLQQQALHSG WKPHRDTHGV EAFQSGQNNY SCTQCGKDFC
210 220 230 240 250
HQHTLFEHQK IHTEERPYEC SECGKLFRYN SDLIKHQRNH TGERPYKCSE
260 270 280 290 300
CGKAFSLKYN VVQHQKIHTG ERPYECSECG KAFLRKSHLL QHQRIHTRPR
310 320 330 340 350
PYVCSECGKA FLTQAHLVGH QKIHTGERPY GCNECGKYFM YSSALIRHQK
360 370 380 390 400
VHTGERPFYC CECGKFFMDS CTLIIHQRVH TGEKPYECNE CGKFFRYRST
410 420 430 440 450
LIRHQKVHTG EKPYECSECG KFFMDTSTLI IHQRVHTGEK PYECNKCGKF
460 470 480 490 500
FRYCFTLNRH QRVHSGERPY ECSECGKFFV DSCTLKSHQR VHTGERPFEC
510 520 530 540 550
SICGKSFRCR STLDTHQRIH TGERPYECSE CGKFFRHNSN HIRHRRNHFG
560 570 580 590 600
ERSFECTECG RVFSQNSHLI RHQKVHTRER TYKCSKCGKF FMDSSTLISH
610 620 630 640 650
ERVHTGEKPY ECSECGKVFR YNSSLIKHRR IHTGERPYQC SECGRVFNQN
660
SHLIQHQKVH TR
Length:662
Mass (Da):77,204
Last modified:March 24, 2009 - v3
Checksum:iDB91A427566145E0
GO
Isoform 2 (identifier: P17021-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MNLTE → MLMDAGQ

Show »
Length:664
Mass (Da):77,362
Checksum:i474EAF6C0C7AE299
GO
Isoform 3 (identifier: P17021-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MNLTEDYMVFEDVAIHFSQEEWGILNDVQRHLHSDVMLENFALLSSV → MGLPLPSKVIMHFMSISVL

Show »
Length:634
Mass (Da):73,781
Checksum:iE160A56AA3A043F3
GO

Sequence cautioni

The sequence BAC04956.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC05252.1 differs from that shown. Reason: Erroneous termination at position 461. Translated as Gln.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti96 – 961I → T in BAC05252 (PubMed:14702039).Curated
Sequence conflicti394 – 3941F → S in BAG54604 (PubMed:14702039).Curated
Sequence conflicti552 – 5521R → G in BAG54682 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti148 – 1481T → K.
Corresponds to variant rs2014827 [ dbSNP | Ensembl ].
VAR_057382

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4747MNLTE…LLSSV → MGLPLPSKVIMHFMSISVL in isoform 3. 1 PublicationVSP_036652Add
BLAST
Alternative sequencei1 – 55MNLTE → MLMDAGQ in isoform 2. 1 PublicationVSP_036651

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097123 mRNA. Translation: BAC04956.1. Different initiation.
AK098183 mRNA. Translation: BAC05252.1. Sequence problems.
AK127948 mRNA. Translation: BAG54604.1.
AK128471 mRNA. Translation: BAG54682.1.
AC003002 Genomic DNA. No translation available.
AB075827 mRNA. Translation: BAB85533.1.
X52341 mRNA. Translation: CAA36567.1.
CCDSiCCDS42636.1. [P17021-1]
PIRiI37949. S10398.
RefSeqiNP_008890.2. NM_006959.2. [P17021-1]
XP_006723415.1. XM_006723352.2. [P17021-2]
UniGeneiHs.729403.

Genome annotation databases

EnsembliENST00000307658; ENSP00000302455; ENSG00000186272. [P17021-2]
ENST00000601808; ENSP00000471905; ENSG00000186272. [P17021-1]
GeneIDi7565.
KEGGihsa:7565.
UCSCiuc002qoo.2. human. [P17021-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097123 mRNA. Translation: BAC04956.1. Different initiation.
AK098183 mRNA. Translation: BAC05252.1. Sequence problems.
AK127948 mRNA. Translation: BAG54604.1.
AK128471 mRNA. Translation: BAG54682.1.
AC003002 Genomic DNA. No translation available.
AB075827 mRNA. Translation: BAB85533.1.
X52341 mRNA. Translation: CAA36567.1.
CCDSiCCDS42636.1. [P17021-1]
PIRiI37949. S10398.
RefSeqiNP_008890.2. NM_006959.2. [P17021-1]
XP_006723415.1. XM_006723352.2. [P17021-2]
UniGeneiHs.729403.

3D structure databases

ProteinModelPortaliP17021.
SMRiP17021. Positions 82-662.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113396. 2 interactions.
IntActiP17021. 1 interaction.
STRINGi9606.ENSP00000471905.

PTM databases

iPTMnetiP17021.
PhosphoSiteiP17021.

Polymorphism and mutation databases

BioMutaiZNF17.
DMDMi229485310.

Proteomic databases

MaxQBiP17021.
PaxDbiP17021.
PeptideAtlasiP17021.
PRIDEiP17021.

Protocols and materials databases

DNASUi7565.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307658; ENSP00000302455; ENSG00000186272. [P17021-2]
ENST00000601808; ENSP00000471905; ENSG00000186272. [P17021-1]
GeneIDi7565.
KEGGihsa:7565.
UCSCiuc002qoo.2. human. [P17021-1]

Organism-specific databases

CTDi7565.
GeneCardsiZNF17.
HGNCiHGNC:12958. ZNF17.
neXtProtiNX_P17021.
PharmGKBiPA37540.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119107.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiP17021.
KOiK09228.
OMAiFFRHNSN.
OrthoDBiEOG7KSX7Q.
PhylomeDBiP17021.
TreeFamiTF339848.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii7565.
PROiP17021.

Gene expression databases

BgeeiP17021.
CleanExiHS_ZNF17.
ExpressionAtlasiP17021. baseline and differential.

Family and domain databases

Gene3Di3.30.160.60. 17 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 3 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 18 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 18 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Liver, Mesenchymal stem cell, Spleen and Trachea.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins."
    Nagase T., Kikuno R., Ohara O.
    DNA Res. 8:319-327(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 55-662 (ISOFORMS 1/2/3).
    Tissue: Brain.
  4. "Multiple genes encoding zinc finger domains are expressed in human T cells."
    Thiesen H.-J.
    New Biol. 2:363-374(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 442-497 (ISOFORMS 1/2/3).
    Tissue: Lymphoid tissue.

Entry informationi

Entry nameiZNF17_HUMAN
AccessioniPrimary (citable) accession number: P17021
Secondary accession number(s): B3KXU2
, B3KY20, Q8N7M1, Q8N893, Q8TF54
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: March 24, 2009
Last modified: July 6, 2016
This is version 141 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.