Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger X-chromosomal protein

Gene

ZFX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Probable transcriptional activator.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri425 – 44723C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri456 – 47823C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri488 – 51023C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri519 – 54224C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri548 – 57023C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri576 – 59924C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri605 – 62723C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri633 – 65624C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri662 – 68423C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri690 – 71324C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri719 – 74123C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri747 – 77024C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri776 – 79823C2H2-type 13PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • metal ion binding Source: UniProtKB-KW
  • RNA polymerase II regulatory region sequence-specific DNA binding Source: GO_Central
  • transcription coactivator activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: GO_Central

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger X-chromosomal protein
Gene namesi
Name:ZFX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:12869. ZFX.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37458.

Polymorphism and mutation databases

BioMutaiZFX.
DMDMi68844748.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 805805Zinc finger X-chromosomal proteinPRO_0000047258Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei274 – 2741PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP17010.
MaxQBiP17010.
PaxDbiP17010.
PeptideAtlasiP17010.
PRIDEiP17010.

PTM databases

iPTMnetiP17010.
PhosphoSiteiP17010.

Expressioni

Gene expression databases

BgeeiP17010.
CleanExiHS_ZFX.
ExpressionAtlasiP17010. baseline and differential.
GenevisibleiP17010. HS.

Organism-specific databases

HPAiHPA001748.
HPA003877.

Interactioni

Protein-protein interaction databases

BioGridi113375. 3 interactions.
IntActiP17010. 3 interactions.
STRINGi9606.ENSP00000304985.

Structurei

3D structure databases

ProteinModelPortaliP17010.
SMRiP17010. Positions 425-804.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 13 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri425 – 44723C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri456 – 47823C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri488 – 51023C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri519 – 54224C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri548 – 57023C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri576 – 59924C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri605 – 62723C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri633 – 65624C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri662 – 68423C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri690 – 71324C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri719 – 74123C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri747 – 77024C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri776 – 79823C2H2-type 13PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063297.
HOVERGENiHBG000337.
InParanoidiP17010.
OMAiGHVGHVE.
OrthoDBiEOG75XGK4.
PhylomeDBiP17010.
TreeFamiTF335557.

Family and domain databases

Gene3Di3.30.160.60. 7 hits.
InterProiIPR006794. Transcrp_activ_Zfx/Zfy-dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
PF04704. Zfx_Zfy_act. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 13 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P17010-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEDGLELQQ EPNSFFDATG ADGTHMDGDQ IVVEVQETVF VSDVVDSDIT
60 70 80 90 100
VHNFVPDDPD SVVIQDVIED VVIEDVQCPD IMEEADVSET VIIPEQVLDS
110 120 130 140 150
DVTEEVSLAH CTVPDDVLAS DITSASMSMP EHVLTGDSIH VSDVGHVGHV
160 170 180 190 200
GHVEHVVHDS VVEAEIVTDP LTTDVVSEEV LVADCASEAV IDANGIPVDQ
210 220 230 240 250
QDDDKGNCED YLMISLDDAG KIEHDGSSGM TMDTESEIDP CKVDGTCPEV
260 270 280 290 300
IKVYIFKADP GEDDLGGTVD IVESEPENDH GVELLDQNSS IRVPREKMVY
310 320 330 340 350
MTVNDSQPED EDLNVAEIAD EVYMEVIVGE EDAAAAAAAA AVHEQQMDDN
360 370 380 390 400
EIKTFMPIAW AAAYGNNSDG IENRNGTASA LLHIDESAGL GRLAKQKPKK
410 420 430 440 450
RRRPDSRQYQ TAIIIGPDGH PLTVYPCMIC GKKFKSRGFL KRHMKNHPEH
460 470 480 490 500
LAKKKYRCTD CDYTTNKKIS LHNHLESHKL TSKAEKAIEC DECGKHFSHA
510 520 530 540 550
GALFTHKMVH KEKGANKMHK CKFCEYETAE QGLLNRHLLA VHSKNFPHIC
560 570 580 590 600
VECGKGFRHP SELKKHMRIH TGEKPYQCQY CEYRSADSSN LKTHVKTKHS
610 620 630 640 650
KEMPFKCDIC LLTFSDTKEV QQHALIHQES KTHQCLHCDH KSSNSSDLKR
660 670 680 690 700
HIISVHTKDY PHKCDMCDKG FHRPSELKKH VAAHKGKKMH QCRHCDFKIA
710 720 730 740 750
DPFVLSRHIL SVHTKDLPFR CKRCRKGFRQ QSELKKHMKT HSGRKVYQCE
760 770 780 790 800
YCEYSTTDAS GFKRHVISIH TKDYPHRCEY CKKGFRRPSE KNQHIMRHHK

EVGLP
Length:805
Mass (Da):90,522
Last modified:July 5, 2005 - v2
Checksum:iB074079D1762A0AD
GO
Isoform 2 (identifier: P17010-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-229: Missing.

Show »
Length:576
Mass (Da):66,065
Checksum:i090B0224004324E0
GO
Isoform 3 (identifier: P17010-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TDRVSFCHPGWSTVAPSGSTATSASQAQVICSASRVTGAT

Note: No experimental confirmation available.
Show »
Length:844
Mass (Da):94,386
Checksum:i2A04EEF5202B8595
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti337 – 3415AAAAA → GHAP in CAA42416 (PubMed:2512506).Curated
Sequence conflicti337 – 3415AAAAA → GHAP in CAA42417 (PubMed:2512506).Curated
Sequence conflicti337 – 3371A → R in AAA61309 (PubMed:2308929).Curated
Sequence conflicti558 – 5581R → S (PubMed:2041734).Curated
Sequence conflicti634 – 6341Missing (PubMed:2041734).Curated
Sequence conflicti683 – 6831A → R (PubMed:2041734).Curated
Sequence conflicti771 – 7711T → R (PubMed:2041734).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 229229Missing in isoform 2. 1 PublicationVSP_014371Add
BLAST
Alternative sequencei19 – 191T → TDRVSFCHPGWSTVAPSGST ATSASQAQVICSASRVTGAT in isoform 3. 1 PublicationVSP_054512

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X59738 mRNA. Translation: CAA42416.1.
X59739 mRNA. Translation: CAA42417.1.
X59740 mRNA. Translation: CAA42418.1.
M30608 mRNA. Translation: AAA61309.1.
AC002404 Genomic DNA. No translation available.
BC136309 mRNA. Translation: AAI36310.1.
AH005875 Genomic DNA. Translation: AAL62492.1.
AF045781 Genomic DNA. Translation: AAC03062.2.
M26946 Genomic DNA. No translation available.
CCDSiCCDS14211.1. [P17010-1]
CCDS55390.1. [P17010-2]
PIRiB35047.
RefSeqiNP_001171555.1. NM_001178084.1. [P17010-1]
NP_001171556.1. NM_001178085.1. [P17010-1]
NP_001171557.1. NM_001178086.1. [P17010-2]
NP_003401.2. NM_003410.3. [P17010-1]
XP_005274648.1. XM_005274591.3. [P17010-1]
XP_005274649.1. XM_005274592.2. [P17010-1]
XP_006724576.1. XM_006724513.2. [P17010-3]
XP_011543879.1. XM_011545577.1. [P17010-3]
XP_011543880.1. XM_011545578.1. [P17010-3]
XP_011543881.1. XM_011545579.1. [P17010-1]
XP_011543882.1. XM_011545580.1. [P17010-1]
XP_011543883.1. XM_011545581.1. [P17010-1]
UniGeneiHs.336681.

Genome annotation databases

EnsembliENST00000304543; ENSP00000304985; ENSG00000005889. [P17010-1]
ENST00000379177; ENSP00000368475; ENSG00000005889. [P17010-1]
ENST00000379188; ENSP00000368486; ENSG00000005889. [P17010-3]
ENST00000539115; ENSP00000438233; ENSG00000005889. [P17010-2]
GeneIDi7543.
KEGGihsa:7543.
UCSCiuc004dbd.3. human. [P17010-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X59738 mRNA. Translation: CAA42416.1.
X59739 mRNA. Translation: CAA42417.1.
X59740 mRNA. Translation: CAA42418.1.
M30608 mRNA. Translation: AAA61309.1.
AC002404 Genomic DNA. No translation available.
BC136309 mRNA. Translation: AAI36310.1.
AH005875 Genomic DNA. Translation: AAL62492.1.
AF045781 Genomic DNA. Translation: AAC03062.2.
M26946 Genomic DNA. No translation available.
CCDSiCCDS14211.1. [P17010-1]
CCDS55390.1. [P17010-2]
PIRiB35047.
RefSeqiNP_001171555.1. NM_001178084.1. [P17010-1]
NP_001171556.1. NM_001178085.1. [P17010-1]
NP_001171557.1. NM_001178086.1. [P17010-2]
NP_003401.2. NM_003410.3. [P17010-1]
XP_005274648.1. XM_005274591.3. [P17010-1]
XP_005274649.1. XM_005274592.2. [P17010-1]
XP_006724576.1. XM_006724513.2. [P17010-3]
XP_011543879.1. XM_011545577.1. [P17010-3]
XP_011543880.1. XM_011545578.1. [P17010-3]
XP_011543881.1. XM_011545579.1. [P17010-1]
XP_011543882.1. XM_011545580.1. [P17010-1]
XP_011543883.1. XM_011545581.1. [P17010-1]
UniGeneiHs.336681.

3D structure databases

ProteinModelPortaliP17010.
SMRiP17010. Positions 425-804.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113375. 3 interactions.
IntActiP17010. 3 interactions.
STRINGi9606.ENSP00000304985.

PTM databases

iPTMnetiP17010.
PhosphoSiteiP17010.

Polymorphism and mutation databases

BioMutaiZFX.
DMDMi68844748.

Proteomic databases

EPDiP17010.
MaxQBiP17010.
PaxDbiP17010.
PeptideAtlasiP17010.
PRIDEiP17010.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304543; ENSP00000304985; ENSG00000005889. [P17010-1]
ENST00000379177; ENSP00000368475; ENSG00000005889. [P17010-1]
ENST00000379188; ENSP00000368486; ENSG00000005889. [P17010-3]
ENST00000539115; ENSP00000438233; ENSG00000005889. [P17010-2]
GeneIDi7543.
KEGGihsa:7543.
UCSCiuc004dbd.3. human. [P17010-1]

Organism-specific databases

CTDi7543.
GeneCardsiZFX.
H-InvDBHIX0056175.
HGNCiHGNC:12869. ZFX.
HPAiHPA001748.
HPA003877.
MIMi314980. gene.
neXtProtiNX_P17010.
PharmGKBiPA37458.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063297.
HOVERGENiHBG000337.
InParanoidiP17010.
OMAiGHVGHVE.
OrthoDBiEOG75XGK4.
PhylomeDBiP17010.
TreeFamiTF335557.

Miscellaneous databases

ChiTaRSiZFX. human.
GeneWikiiZFX.
GenomeRNAii7543.
PROiP17010.
SOURCEiSearch...

Gene expression databases

BgeeiP17010.
CleanExiHS_ZFX.
ExpressionAtlasiP17010. baseline and differential.
GenevisibleiP17010. HS.

Family and domain databases

Gene3Di3.30.160.60. 7 hits.
InterProiIPR006794. Transcrp_activ_Zfx/Zfy-dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
PF04704. Zfx_Zfy_act. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 13 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Putative transcription activator with alternative isoforms encoded by human ZFX gene."
    Schneider-Gaedicke A., Beer-Romero P., Brown L.G., Mardon G., Luoh S.W., Page D.C.
    Nature 342:708-711(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  5. "Exon-intron structure of the X and Y-linked zinc finger protein in mammals."
    Poloumienko A., Blecher S.R.
    Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-411.
  6. "ZFX has a gene structure similar to ZFY, the putative human sex determinant, and escapes X inactivation."
    Schneider-Gaedicke A., Beer-Romero P., Brown L.G., Nussbaum R., Page D.C.
    Cell 57:1247-1258(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 413-805.
  7. "Comparison of ZFY and ZFX gene structure and analysis of alternative 3' untranslated regions of ZFY."
    North M., Sargent C., O'Brien J., Taylor K., Wolfe J., Affara N.A., Ferguson-Smith M.A.
    Nucleic Acids Res. 19:2579-2586(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 427-805.

Entry informationi

Entry nameiZFX_HUMAN
AccessioniPrimary (citable) accession number: P17010
Secondary accession number(s): B9EG97, O43668, Q8WYJ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: July 5, 2005
Last modified: July 6, 2016
This is version 164 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.