Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stathmin

Gene

STMN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).By similarity

GO - Molecular functioni

  • signal transducer activity Source: ProtInc
  • tubulin binding Source: MGI

GO - Biological processi

  • axonogenesis Source: Ensembl
  • brain development Source: Ensembl
  • intracellular signal transduction Source: ProtInc
  • microtubule depolymerization Source: MGI
  • mitotic cytokinesis Source: GO_Central
  • mitotic spindle organization Source: MGI
  • negative regulation of microtubule polymerization Source: Ensembl
  • neuron projection development Source: GO_Central
  • positive regulation of cellular component movement Source: Ensembl
  • regulation of cytoskeleton organization Source: GO_Central
  • response to virus Source: UniProtKB
  • signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis

Enzyme and pathway databases

SignaLinkiP16949.
SIGNORiP16949.

Names & Taxonomyi

Protein namesi
Recommended name:
Stathmin
Alternative name(s):
Leukemia-associated phosphoprotein p18
Metablastin
Oncoprotein 18
Short name:
Op18
Phosphoprotein p19
Short name:
pp19
Prosolin
Protein Pr22
pp17
Gene namesi
Name:STMN1
Synonyms:C1orf215, LAP18, OP18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:6510. STMN1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: GO_Central
  • cytosol Source: Ensembl
  • extracellular exosome Source: UniProtKB
  • intracellular Source: LIFEdb
  • membrane Source: Ensembl
  • microtubule Source: UniProtKB-KW
  • neuron projection Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35491.

Polymorphism and mutation databases

BioMutaiSTMN1.
DMDMi134973.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedCombined sources1 Publication
Chaini2 – 149148StathminPRO_0000182389Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineCombined sources1 Publication
Modified residuei4 – 41PhosphoserineCombined sources
Modified residuei9 – 91N6-acetyllysineCombined sources
Modified residuei16 – 161PhosphoserineCombined sources2 Publications
Modified residuei25 – 251Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications
Modified residuei31 – 311PhosphoserineCombined sources
Modified residuei38 – 381Phosphoserine; by CDK1, MAPK1 and MAPK3Combined sources4 Publications
Modified residuei63 – 631Phosphoserine; by PKACombined sources
Modified residuei100 – 1001N6-acetyllysineCombined sources
Modified residuei119 – 1191N6-acetyllysineCombined sources

Post-translational modificationi

Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity.By similarity4 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP16949.
MaxQBiP16949.
PaxDbiP16949.
PeptideAtlasiP16949.
PRIDEiP16949.
TopDownProteomicsiP16949-1. [P16949-1]
P16949-2. [P16949-2]

2D gel databases

DOSAC-COBS-2DPAGEP16949.
REPRODUCTION-2DPAGEIPI00479997.
SWISS-2DPAGEP16949.
UCD-2DPAGEP16949.

PTM databases

iPTMnetiP16949.
PhosphoSiteiP16949.

Expressioni

Tissue specificityi

Ubiquitous. Expression is strongest in fetal and adult brain, spinal cord, and cerebellum, followed by thymus, bone marrow, testis, and fetal liver. Expression is intermediate in colon, ovary, placenta, uterus, and trachea, and is readily detected at substantially lower levels in all other tissues examined. Lowest expression is found in adult liver. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, non-leukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.2 Publications

Inductioni

Down-regulated in response to enterovirus 71 (EV71) infection (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000117632.
CleanExiHS_STMN1.
ExpressionAtlasiP16949. baseline and differential.
GenevisibleiP16949. HS.

Organism-specific databases

HPAiCAB010107.

Interactioni

Subunit structurei

Binds to two alpha/beta-tubulin heterodimers. Interacts with KIST.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SESTD1Q86VW03EBI-445909,EBI-6117072

GO - Molecular functioni

  • tubulin binding Source: MGI

Protein-protein interaction databases

BioGridi110119. 61 interactions.
IntActiP16949. 16 interactions.
MINTiMINT-2860454.
STRINGi9606.ENSP00000410452.

Structurei

3D structure databases

DisProtiDP00174.
ProteinModelPortaliP16949.
SMRiP16949. Positions 6-141.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 145142SLDPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili41 – 140100Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the stathmin family.Curated
Contains 1 SLD (stathmin-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410KGH8. Eukaryota.
ENOG4110S9Z. LUCA.
GeneTreeiENSGT00390000003691.
HOGENOMiHOG000013197.
HOVERGENiHBG054037.
InParanoidiP16949.
KOiK04381.
OMAiDAKSEFP.
OrthoDBiEOG091G0Y2U.
PhylomeDBiP16949.
TreeFamiTF326935.

Family and domain databases

InterProiIPR030514. Stathmin_CS.
IPR000956. Stathmin_fam.
[Graphical view]
PANTHERiPTHR10104. PTHR10104. 1 hit.
PfamiPF00836. Stathmin. 1 hit.
[Graphical view]
PIRSFiPIRSF002285. Stathmin. 1 hit.
PRINTSiPR00345. STATHMIN.
SUPFAMiSSF101494. SSF101494. 1 hit.
PROSITEiPS00563. STATHMIN_1. 1 hit.
PS01041. STATHMIN_2. 1 hit.
PS51663. STATHMIN_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P16949-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI
60 70 80 90 100
QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK
110 120 130 140
LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEAD
Length:149
Mass (Da):17,303
Last modified:January 23, 2007 - v3
Checksum:i316426F60DABCD01
GO
Isoform 2 (identifier: P16949-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-149: DKHIEEVRKNKESKDPADETEAD → MYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):19,824
Checksum:i7F66FFAB6C32A5AB
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei127 – 14923DKHIE…ETEAD → MYFWTHGPGAHPAQISAEQS CLHSVPALCPALGLQSALIT WSDLSHHH in isoform 2. 1 PublicationVSP_041377Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04991 mRNA. Translation: AAA59980.1.
M31303 Genomic DNA. Translation: AAA59971.1.
X53305 mRNA. Translation: CAA37391.1.
Z11566 mRNA. Translation: CAA77660.1.
X94912 Genomic DNA. Translation: CAA64398.1.
AK303692 mRNA. Translation: BAH14020.1.
AK311801 mRNA. Translation: BAG34744.1.
AL033528 Genomic DNA. Translation: CAC16020.1.
CH471059 Genomic DNA. Translation: EAX07854.1.
CH471059 Genomic DNA. Translation: EAX07855.1.
CH471059 Genomic DNA. Translation: EAX07856.1.
CH471059 Genomic DNA. Translation: EAX07857.1.
CH471059 Genomic DNA. Translation: EAX07858.1.
CH471059 Genomic DNA. Translation: EAX07859.1.
CH471059 Genomic DNA. Translation: EAX07860.1.
BC082228 mRNA. Translation: AAH82228.1.
CCDSiCCDS269.1. [P16949-1]
CCDS44090.1. [P16949-2]
PIRiA40936.
RefSeqiNP_001138926.1. NM_001145454.2. [P16949-2]
NP_005554.1. NM_005563.3. [P16949-1]
NP_981944.1. NM_203399.1. [P16949-1]
NP_981946.1. NM_203401.1. [P16949-1]
UniGeneiHs.209983.

Genome annotation databases

EnsembliENST00000357865; ENSP00000350531; ENSG00000117632. [P16949-1]
ENST00000374291; ENSP00000363409; ENSG00000117632. [P16949-1]
ENST00000399728; ENSP00000382633; ENSG00000117632. [P16949-1]
ENST00000426559; ENSP00000410452; ENSG00000117632. [P16949-2]
ENST00000455785; ENSP00000387858; ENSG00000117632. [P16949-1]
GeneIDi3925.
KEGGihsa:3925.
UCSCiuc001bkz.4. human. [P16949-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J04991 mRNA. Translation: AAA59980.1.
M31303 Genomic DNA. Translation: AAA59971.1.
X53305 mRNA. Translation: CAA37391.1.
Z11566 mRNA. Translation: CAA77660.1.
X94912 Genomic DNA. Translation: CAA64398.1.
AK303692 mRNA. Translation: BAH14020.1.
AK311801 mRNA. Translation: BAG34744.1.
AL033528 Genomic DNA. Translation: CAC16020.1.
CH471059 Genomic DNA. Translation: EAX07854.1.
CH471059 Genomic DNA. Translation: EAX07855.1.
CH471059 Genomic DNA. Translation: EAX07856.1.
CH471059 Genomic DNA. Translation: EAX07857.1.
CH471059 Genomic DNA. Translation: EAX07858.1.
CH471059 Genomic DNA. Translation: EAX07859.1.
CH471059 Genomic DNA. Translation: EAX07860.1.
BC082228 mRNA. Translation: AAH82228.1.
CCDSiCCDS269.1. [P16949-1]
CCDS44090.1. [P16949-2]
PIRiA40936.
RefSeqiNP_001138926.1. NM_001145454.2. [P16949-2]
NP_005554.1. NM_005563.3. [P16949-1]
NP_981944.1. NM_203399.1. [P16949-1]
NP_981946.1. NM_203401.1. [P16949-1]
UniGeneiHs.209983.

3D structure databases

DisProtiDP00174.
ProteinModelPortaliP16949.
SMRiP16949. Positions 6-141.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110119. 61 interactions.
IntActiP16949. 16 interactions.
MINTiMINT-2860454.
STRINGi9606.ENSP00000410452.

PTM databases

iPTMnetiP16949.
PhosphoSiteiP16949.

Polymorphism and mutation databases

BioMutaiSTMN1.
DMDMi134973.

2D gel databases

DOSAC-COBS-2DPAGEP16949.
REPRODUCTION-2DPAGEIPI00479997.
SWISS-2DPAGEP16949.
UCD-2DPAGEP16949.

Proteomic databases

EPDiP16949.
MaxQBiP16949.
PaxDbiP16949.
PeptideAtlasiP16949.
PRIDEiP16949.
TopDownProteomicsiP16949-1. [P16949-1]
P16949-2. [P16949-2]

Protocols and materials databases

DNASUi3925.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357865; ENSP00000350531; ENSG00000117632. [P16949-1]
ENST00000374291; ENSP00000363409; ENSG00000117632. [P16949-1]
ENST00000399728; ENSP00000382633; ENSG00000117632. [P16949-1]
ENST00000426559; ENSP00000410452; ENSG00000117632. [P16949-2]
ENST00000455785; ENSP00000387858; ENSG00000117632. [P16949-1]
GeneIDi3925.
KEGGihsa:3925.
UCSCiuc001bkz.4. human. [P16949-1]

Organism-specific databases

CTDi3925.
GeneCardsiSTMN1.
HGNCiHGNC:6510. STMN1.
HPAiCAB010107.
MIMi151442. gene.
neXtProtiNX_P16949.
PharmGKBiPA35491.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KGH8. Eukaryota.
ENOG4110S9Z. LUCA.
GeneTreeiENSGT00390000003691.
HOGENOMiHOG000013197.
HOVERGENiHBG054037.
InParanoidiP16949.
KOiK04381.
OMAiDAKSEFP.
OrthoDBiEOG091G0Y2U.
PhylomeDBiP16949.
TreeFamiTF326935.

Enzyme and pathway databases

SignaLinkiP16949.
SIGNORiP16949.

Miscellaneous databases

ChiTaRSiSTMN1. human.
GeneWikiiStathmin.
GenomeRNAii3925.
PROiP16949.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000117632.
CleanExiHS_STMN1.
ExpressionAtlasiP16949. baseline and differential.
GenevisibleiP16949. HS.

Family and domain databases

InterProiIPR030514. Stathmin_CS.
IPR000956. Stathmin_fam.
[Graphical view]
PANTHERiPTHR10104. PTHR10104. 1 hit.
PfamiPF00836. Stathmin. 1 hit.
[Graphical view]
PIRSFiPIRSF002285. Stathmin. 1 hit.
PRINTSiPR00345. STATHMIN.
SUPFAMiSSF101494. SSF101494. 1 hit.
PROSITEiPS00563. STATHMIN_1. 1 hit.
PS01041. STATHMIN_2. 1 hit.
PS51663. STATHMIN_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTMN1_HUMAN
AccessioniPrimary (citable) accession number: P16949
Secondary accession number(s): A2A2D1
, B2R4E7, B7Z8N4, D3DPJ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 180 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.