Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cAMP-dependent protein kinase type I regulatory subunit

Gene

Pka-R1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei197 – 1971cAMP 1
Binding sitei206 – 2061cAMP 1
Binding sitei321 – 3211cAMP 2
Binding sitei330 – 3301cAMP 2

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi132 – 247116cAMP 1Add
BLAST
Nucleotide bindingi250 – 371122cAMP 2Add
BLAST

GO - Molecular functioni

  • cAMP binding Source: UniProtKB-KW
  • cAMP-dependent protein kinase regulator activity Source: FlyBase
  • cyclic nucleotide binding Source: FlyBase

GO - Biological processi

  • actin filament organization Source: FlyBase
  • cAMP-mediated signaling Source: FlyBase
  • molting cycle, chitin-based cuticle Source: FlyBase
  • neuromuscular synaptic transmission Source: FlyBase
  • olfactory learning Source: FlyBase
  • oocyte microtubule cytoskeleton polarization Source: FlyBase
  • positive regulation of feeding behavior Source: FlyBase
  • response to ethanol Source: FlyBase
  • ventral cord development Source: FlyBase
Complete GO annotation...

Keywords - Ligandi

cAMP, cAMP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-DME-163615. PKA activation.
R-DME-164378. PKA activation in glucagon signalling.
R-DME-180024. DARPP-32 events.
R-DME-432040. Vasopressin regulates renal water homeostasis via Aquaporins.
R-DME-5610787. Hedgehog 'off' state.
R-DME-983231. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-dependent protein kinase type I regulatory subunit
Short name:
DRI class I to class IV
Gene namesi
Name:Pka-R1
Synonyms:CdkR
ORF Names:CG3263
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0259243. Pka-R1.

Subcellular locationi

GO - Cellular componenti

  • cAMP-dependent protein kinase complex Source: FlyBase
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 376376cAMP-dependent protein kinase type I regulatory subunitPRO_0000205396Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi17 – 17Interchain (with C-38)By similarity
Disulfide bondi38 – 38Interchain (with C-17)By similarity
Modified residuei96 – 961PhosphoserineBy similarity

Post-translational modificationi

The pseudophosphorylation site binds to the substrate-binding region of the catalytic chain but is not phosphorylated. The physiological significance of phosphorylations by other kinases is unclear.

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDbiP16905.
PRIDEiP16905.

Expressioni

Gene expression databases

BgeeiFBgn0259243.
ExpressionAtlasiP16905. differential.
GenevisibleiP16905. DM.

Interactioni

Subunit structurei

Tetramer, composed of 2 regulatory (R) and 2 catalytic (C) subunits. In the presence of cAMP it dissociates into 2 active monomeric C subunits and an R dimer.

Protein-protein interaction databases

BioGridi65562. 2 interactions.
DIPiDIP-23282N.
IntActiP16905. 1 interaction.
STRINGi7227.FBpp0291777.

Structurei

3D structure databases

ProteinModelPortaliP16905.
SMRiP16905. Positions 13-375.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 131131Dimerization and phosphorylationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi91 – 955Pseudophosphorylation motif

Sequence similaritiesi

Contains 2 cyclic nucleotide-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1113. Eukaryota.
COG0664. LUCA.
GeneTreeiENSGT00530000062947.
InParanoidiP16905.
KOiK04739.
OrthoDBiEOG091G0F1K.
PhylomeDBiP16905.

Family and domain databases

Gene3Di2.60.120.10. 2 hits.
InterProiIPR012198. cAMP_dep_PK_reg_su.
IPR003117. cAMP_dep_PK_reg_su_I/II_a/b.
IPR018490. cNMP-bd-like.
IPR018488. cNMP-bd_CS.
IPR000595. cNMP-bd_dom.
IPR014710. RmlC-like_jellyroll.
[Graphical view]
PfamiPF00027. cNMP_binding. 2 hits.
PF02197. RIIa. 1 hit.
[Graphical view]
PIRSFiPIRSF000548. PK_regulatory. 1 hit.
SMARTiSM00100. cNMP. 2 hits.
SM00394. RIIa. 1 hit.
[Graphical view]
SUPFAMiSSF47391. SSF47391. 1 hit.
SSF51206. SSF51206. 2 hits.
PROSITEiPS00888. CNMP_BINDING_1. 2 hits.
PS00889. CNMP_BINDING_2. 2 hits.
PS50042. CNMP_BINDING_3. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P16905-1) [UniParc]FASTAAdd to basket
Also known as: DRI-1, A, C, G, H, I, J

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSYMMAKTLE EQSLRECEHY IQTHGIQRVL KDCIVQLCVC RPENPVQFLR
60 70 80 90 100
QYFQKLEREQ VKLDASRQVI SPDDCEDLSP MPQTAAPPVR RRGGISAEPV
110 120 130 140 150
TEEDATNYVK KVVPKDYKTM NALSKAIAKN VLFAHLDESE RSDIFDAMFP
160 170 180 190 200
VNHIAGENII QQGDEGDNFY VIDVGEVDVF VNSELVTTIS EGGSFGELAL
210 220 230 240 250
IYGTPRAATV RAKTDVKLWG IDRDSYRRIL MGSTIRKRKM YEEFLSRVSI
260 270 280 290 300
LESLDKWERL TVADSLETCS FDDGETIVKQ GAAGDDFYII LEGCAVVLQQ
310 320 330 340 350
RSEGEDPAEV GRLGSSDYFG EIALLLDRPR AATVVARGPL KCVKLDRARF
360 370
ERVLGPCADI LKRNITQYNS FVSLSV
Length:376
Mass (Da):42,239
Last modified:August 29, 2003 - v2
Checksum:iF7B89D9C3EC313A5
GO
Isoform 2 (identifier: P16905-2) [UniParc]FASTAAdd to basket
Also known as: DRI-2, D

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLER → MPK

Show »
Length:321
Mass (Da):35,551
Checksum:i644D55160B4752A5
GO
Isoform 3 (identifier: P16905-3) [UniParc]FASTAAdd to basket
Also known as: DRI-3-4, B, F

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Show »
Length:296
Mass (Da):32,768
Checksum:i56143C5389FA0CFD
GO
Isoform E (identifier: P16905-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-58: Missing.

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):35,326
Checksum:i32E6701C3CD4A40A
GO

Sequence cautioni

The sequence AAN71433 differs from that shown. Reason: Frameshift at position 189. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti303 – 3031E → EQ in CAA34837 (PubMed:3215511).Curated
Sequence conflicti303 – 3031E → EQ in CAA34838 (PubMed:3215511).Curated
Sequence conflicti303 – 3031E → EQ in CAA34839 (PubMed:3215511).Curated
Sequence conflicti303 – 3031E → EQ in CAA34841 (PubMed:3215511).Curated
Isoform 2 (identifier: P16905-2)
Sequence conflicti1 – 33MPK → M in CAA34837 (PubMed:3215511).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8080Missing in isoform 3. 1 PublicationVSP_002796Add
BLAST
Alternative sequencei1 – 5858MSYMM…QKLER → MPK in isoform 2. 1 PublicationVSP_002795Add
BLAST
Alternative sequencei2 – 5857Missing in isoform E. CuratedVSP_036066Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16963, X16964 Genomic DNA. Translation: CAA34837.1.
X16970, X16971 Genomic DNA. Translation: CAA34841.1.
X16966 Genomic DNA. Translation: CAA34838.1.
X16968 Genomic DNA. Translation: CAA34839.1.
AE014296 Genomic DNA. Translation: AAF51649.3.
AE014296 Genomic DNA. Translation: AAG22179.2.
AE014296 Genomic DNA. Translation: AAN12146.2.
AE014296 Genomic DNA. Translation: AAN12147.1.
AE014296 Genomic DNA. Translation: AAX52761.1.
AE014296 Genomic DNA. Translation: AAX52762.1.
AE014296 Genomic DNA. Translation: AAX52763.1.
AE014296 Genomic DNA. Translation: AAX52764.1.
AE014296 Genomic DNA. Translation: AAX52765.1.
AE014296 Genomic DNA. Translation: AAX52766.1.
AY058709 mRNA. Translation: AAL13938.1.
AY122131 mRNA. Translation: AAM52643.1.
BT001678 mRNA. Translation: AAN71433.1. Frameshift.
PIRiA31751. OKFF1R.
RefSeqiNP_001014593.1. NM_001014593.3. [P16905-1]
NP_001014594.1. NM_001014594.3. [P16905-1]
NP_001014595.1. NM_001014595.3. [P16905-1]
NP_001014596.1. NM_001014596.3. [P16905-1]
NP_001014597.1. NM_001014597.2. [P16905-3]
NP_001014598.1. NM_001014598.2. [P16905-4]
NP_001189145.1. NM_001202216.1.
NP_001189146.1. NM_001202217.1.
NP_001189147.1. NM_001202218.2.
NP_001189148.1. NM_001202219.2.
NP_001189149.1. NM_001202220.2.
NP_524189.2. NM_079465.4. [P16905-3]
NP_730573.2. NM_168875.4. [P16905-1]
NP_730574.2. NM_168876.6. [P16905-1]
NP_730576.1. NM_168877.2. [P16905-2]
UniGeneiDm.15092.

Genome annotation databases

EnsemblMetazoaiFBtr0299891; FBpp0289169; FBgn0259243. [P16905-1]
FBtr0299892; FBpp0289170; FBgn0259243. [P16905-1]
FBtr0300528; FBpp0289755; FBgn0259243. [P16905-1]
FBtr0300530; FBpp0289757; FBgn0259243. [P16905-1]
FBtr0300534; FBpp0289761; FBgn0259243. [P16905-1]
FBtr0300535; FBpp0289762; FBgn0259243. [P16905-1]
GeneIDi40305.
KEGGidme:Dmel_CG42341.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X16963, X16964 Genomic DNA. Translation: CAA34837.1.
X16970, X16971 Genomic DNA. Translation: CAA34841.1.
X16966 Genomic DNA. Translation: CAA34838.1.
X16968 Genomic DNA. Translation: CAA34839.1.
AE014296 Genomic DNA. Translation: AAF51649.3.
AE014296 Genomic DNA. Translation: AAG22179.2.
AE014296 Genomic DNA. Translation: AAN12146.2.
AE014296 Genomic DNA. Translation: AAN12147.1.
AE014296 Genomic DNA. Translation: AAX52761.1.
AE014296 Genomic DNA. Translation: AAX52762.1.
AE014296 Genomic DNA. Translation: AAX52763.1.
AE014296 Genomic DNA. Translation: AAX52764.1.
AE014296 Genomic DNA. Translation: AAX52765.1.
AE014296 Genomic DNA. Translation: AAX52766.1.
AY058709 mRNA. Translation: AAL13938.1.
AY122131 mRNA. Translation: AAM52643.1.
BT001678 mRNA. Translation: AAN71433.1. Frameshift.
PIRiA31751. OKFF1R.
RefSeqiNP_001014593.1. NM_001014593.3. [P16905-1]
NP_001014594.1. NM_001014594.3. [P16905-1]
NP_001014595.1. NM_001014595.3. [P16905-1]
NP_001014596.1. NM_001014596.3. [P16905-1]
NP_001014597.1. NM_001014597.2. [P16905-3]
NP_001014598.1. NM_001014598.2. [P16905-4]
NP_001189145.1. NM_001202216.1.
NP_001189146.1. NM_001202217.1.
NP_001189147.1. NM_001202218.2.
NP_001189148.1. NM_001202219.2.
NP_001189149.1. NM_001202220.2.
NP_524189.2. NM_079465.4. [P16905-3]
NP_730573.2. NM_168875.4. [P16905-1]
NP_730574.2. NM_168876.6. [P16905-1]
NP_730576.1. NM_168877.2. [P16905-2]
UniGeneiDm.15092.

3D structure databases

ProteinModelPortaliP16905.
SMRiP16905. Positions 13-375.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi65562. 2 interactions.
DIPiDIP-23282N.
IntActiP16905. 1 interaction.
STRINGi7227.FBpp0291777.

Proteomic databases

PaxDbiP16905.
PRIDEiP16905.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0299891; FBpp0289169; FBgn0259243. [P16905-1]
FBtr0299892; FBpp0289170; FBgn0259243. [P16905-1]
FBtr0300528; FBpp0289755; FBgn0259243. [P16905-1]
FBtr0300530; FBpp0289757; FBgn0259243. [P16905-1]
FBtr0300534; FBpp0289761; FBgn0259243. [P16905-1]
FBtr0300535; FBpp0289762; FBgn0259243. [P16905-1]
GeneIDi40305.
KEGGidme:Dmel_CG42341.

Organism-specific databases

CTDi40305.
FlyBaseiFBgn0259243. Pka-R1.

Phylogenomic databases

eggNOGiKOG1113. Eukaryota.
COG0664. LUCA.
GeneTreeiENSGT00530000062947.
InParanoidiP16905.
KOiK04739.
OrthoDBiEOG091G0F1K.
PhylomeDBiP16905.

Enzyme and pathway databases

ReactomeiR-DME-163615. PKA activation.
R-DME-164378. PKA activation in glucagon signalling.
R-DME-180024. DARPP-32 events.
R-DME-432040. Vasopressin regulates renal water homeostasis via Aquaporins.
R-DME-5610787. Hedgehog 'off' state.
R-DME-983231. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

ChiTaRSiPka-R1. fly.
GenomeRNAii40305.
PROiP16905.

Gene expression databases

BgeeiFBgn0259243.
ExpressionAtlasiP16905. differential.
GenevisibleiP16905. DM.

Family and domain databases

Gene3Di2.60.120.10. 2 hits.
InterProiIPR012198. cAMP_dep_PK_reg_su.
IPR003117. cAMP_dep_PK_reg_su_I/II_a/b.
IPR018490. cNMP-bd-like.
IPR018488. cNMP-bd_CS.
IPR000595. cNMP-bd_dom.
IPR014710. RmlC-like_jellyroll.
[Graphical view]
PfamiPF00027. cNMP_binding. 2 hits.
PF02197. RIIa. 1 hit.
[Graphical view]
PIRSFiPIRSF000548. PK_regulatory. 1 hit.
SMARTiSM00100. cNMP. 2 hits.
SM00394. RIIa. 1 hit.
[Graphical view]
SUPFAMiSSF47391. SSF47391. 1 hit.
SSF51206. SSF51206. 2 hits.
PROSITEiPS00888. CNMP_BINDING_1. 2 hits.
PS00889. CNMP_BINDING_2. 2 hits.
PS50042. CNMP_BINDING_3. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKAPR1_DROME
AccessioniPrimary (citable) accession number: P16905
Secondary accession number(s): A4V272
, A4V277, Q59E10, Q8IGP3, Q8IPU2, Q8MR47, Q95TK7, Q9VPA6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: August 29, 2003
Last modified: September 7, 2016
This is version 166 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.