Reviewed,
UniProtKB/Swiss-Prot P16615 (AT2A2_HUMAN)
Last modified
February 9, 2010.
Version 131.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 Short name=SR Ca(2+)-ATPase 2 Short name=SERCA2 EC=3.6.3.8 Alternative name(s): Calcium pump 2 Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform Endoplasmic reticulum class 1/2 Ca(2+) ATPase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1042 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform SERCA2A is involved in the regulation of the contraction/relaxation cycle. |
| Catalytic activity | ATP + H2O + Ca2+(Cis) = ADP + phosphate + Ca2+(Trans). |
| Enzyme regulation | Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN By similarity. |
| Subunit structure | Associated with phospholamban (PLN) By similarity. Isoform SERCA2B interacts with TRAM2 (via C-terminus). Interacts with HAX1. Ref.3 Ref.10 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Isoform SERCA2A is highly expressed in heart and slow twitch skeletal muscle. Isoform SERCA2B is widely expressed, in smooth muscle and nonmuscle tissues such as in adult skin epidermis. Ref.14 |
| Post-translational modification | Nitrated under oxidative stress. Nitration on the two tyrosine residues inhibits catalytic activity. |
| Involvement in disease | Defects in ATP2A2 are a cause of acrokeratosis verruciformis (AKV) [MIM:101900]; also known as Hopf disease. AKV is a localized disorder of keratinization, which is inherited as an autosomal dominant trait. Its onset is early in life with multiple flat-topped, flesh-colored papules on the hands and feet, punctate keratoses on the palms and soles, with varying degrees of nail involvement. The histopathology shows a distinctive pattern of epidermal features with hyperkeratosis, hypergranulosis, and acanthosis together with papillomatosis. These changes are frequently associated with circumscribed elevations of the epidermis that are said to resemble church spires. There are no features of dyskeratosis or acantholysis, the typical findings in lesions of Darier disease. Ref.17 Defects in ATP2A2 are the cause of Darier disease (DD) [MIM:124200]; also known as Darier-White disease (DAR). DD is an autosomal dominantly inherited skin disorder characterized by loss of adhesion between epidermal cells (acantholysis) and abnormal keratinization. Patients with mild disease may have no more than a few scattered keratotic papules or subtle nail changes, whereas those with severe disease are handicapped by widespread malodorous keratotic plaques. In a few families, neuropsychiatric abnormalities such as mild mental retardation, schizophrenia, bipolar disorder and epilepsy have been reported. Stress, UV exposure, heat, sweat, friction, and oral contraception exacerbate disease symptoms. Prevalence has been estimated at 1 in 50000. Ref.14 Ref.13 Ref.15 Ref.16 |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) family. Type IIA subfamily. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: SERCA2 transcripts differ only in their 3'-UTR region and are expressed in a tissue-specific manner. | ||||||
| Isoform SERCA2B (identifier: P16615-1) Also known as: ATP2A2B; Class 2-4; HK1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Ubiquitous housekeeping isoform. | ||||||
| Isoform SERCA2A (identifier: P16615-2) Also known as: ATP2A2A; Class 1; HK2; The sequence of this isoform differs from the canonical sequence as follows: 994-1042: GKECVQPATKSCSFSACTDGISWPFVLLIMPLVIWVYSTDTNFSDMFWS → AILE | ||||||
| Note: Cardiac/slow twitch, muscle specific isoform. Has a lower affinity for calcium and a higher catalytic turnover rate. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1042 | 1042 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 | PRO_0000046196 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | 1 By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | 2 By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | 3 By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | 4 By similarity | ||||||
| Topological domain | 314 – 756 | 443 | Cytoplasmic By similarity | ||||||
| Transmembrane | 757 – 776 | 20 | 5 By similarity | ||||||
| Topological domain | 777 – 786 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 787 – 807 | 21 | 6 By similarity | ||||||
| Topological domain | 808 – 827 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 828 – 850 | 23 | 7 By similarity | ||||||
| Topological domain | 851 – 896 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 897 – 916 | 20 | 8 By similarity | ||||||
| Topological domain | 917 – 929 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 930 – 948 | 19 | 9 By similarity | ||||||
| Topological domain | 949 – 963 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 964 – 984 | 21 | 10 By similarity | ||||||
| Topological domain | 985 – 1042 | 58 | Cytoplasmic By similarity | ||||||
| Region | 370 – 400 | 31 | Interacts with phospholamban 1 By similarity | ||||||
| Region | 575 – 594 | 20 | Interacts with HAX1 | ||||||
| Region | 787 – 807 | 21 | Interacts with phospholamban 2 By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 702 | 1 | Magnesium By similarity | ||||||
| Metal binding | 706 | 1 | Magnesium By similarity | ||||||
| Metal binding | 767 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 770 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 795 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 798 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 907 | 1 | Calcium 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 294 | 1 | Nitrated tyrosine Ref.5 | ||||||
| Modified residue | 295 | 1 | Nitrated tyrosine Ref.5 | ||||||
| Modified residue | 464 | 1 | N6-acetyllysine Ref.12 | ||||||
| Modified residue | 537 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 663 | 1 | Phosphoserine Ref.4 Ref.6 Ref.7 Ref.8 Ref.11 | ||||||
| Cross-link | 143 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1042 | 49 | GKECV…DMFWS → AILE in isoform SERCA2A. | VSP_000358 | |||||
| Natural variant | 23 | 1 | G → E in DD. dbSNP rs28929478. Ref.16 | VAR_008608 | |||||
| Natural variant | 39 | 1 | N → T in DD. Ref.15 | VAR_008609 | |||||
| Natural variant | 47 | 1 | K → KMFLTGK in DD. | VAR_008610 | |||||
| Natural variant | 65 | 1 | L → S in DD; severe form. | VAR_008611 | |||||
| Natural variant | 131 | 1 | R → Q in DD. | VAR_008612 | |||||
| Natural variant | 160 | 1 | P → L in DD. | VAR_008613 | |||||
| Natural variant | 186 | 1 | S → P in DD. | VAR_008614 | |||||
| Natural variant | 211 | 1 | G → D in DD; severe form. | VAR_008615 | |||||
| Natural variant | 223 | 1 | V → M in DD. | VAR_008616 | |||||
| Natural variant | 268 | 1 | C → F in DD; haemorrhagic lesions. | VAR_008617 | |||||
| Natural variant | 310 | 1 | G → V in DD. | VAR_008618 | |||||
| Natural variant | 318 | 1 | C → R in DD; severe form. | VAR_008619 | |||||
| Natural variant | 348 | 1 | I → T in DD. | VAR_008620 | |||||
| Natural variant | 357 | 1 | T → K in DD. Ref.16 | VAR_009508 | |||||
| Natural variant | 412 | 1 | E → G in DD. | VAR_008621 | |||||
| Natural variant | 495 | 1 | S → F in DD. Ref.16 | VAR_008622 | |||||
| Natural variant | 560 | 1 | C → R in DD; neuropsychiatric phenotype. Ref.15 | VAR_008623 | |||||
| Natural variant | 602 | 1 | P → L in AKV; loss of activity. Ref.17 | VAR_017532 | |||||
| Natural variant | 675 | 1 | F → S in DD; multiple neuropsychiatric features. | VAR_008624 | |||||
| Natural variant | 683 | 1 | K → E in DD; depression. | VAR_008625 | |||||
| Natural variant | 702 | 1 | D → N in DD; moderate form. | VAR_008626 | |||||
| Natural variant | 745 | 1 | A → D in DD; moderate form. | VAR_008627 | |||||
| Natural variant | 749 | 1 | G → R in DD. Ref.16 | VAR_009509 | |||||
| Natural variant | 754 | 1 | Missing in DD. | VAR_008628 | |||||
| Natural variant | 765 | 1 | S → L in DD. Ref.15 | VAR_008629 | |||||
| Natural variant | 767 | 1 | N → S in DD; haemorrhagic lesions and neuropsychiatric phenotype. | VAR_008630 | |||||
| Natural variant | 769 | 1 | G → R in DD. | VAR_008631 | |||||
| Natural variant | 803 | 1 | A → T in DD; mild/moderate form. | VAR_008632 | |||||
| Natural variant | 838 | 1 | A → P in DD; severe form; petit mal epilepsy. | VAR_008633 | |||||
| Natural variant | 843 | 1 | V → F in DD; depression. | VAR_008634 | |||||
| Natural variant | 875 | 1 | C → G in DD; retinitis pigmentosa. | VAR_008635 | |||||
| Natural variant | 920 | 1 | S → Y in DD; mild/moderate/severe form; one patient with epilepsy. | VAR_008636 | |||||
| Natural variant | 943 | 1 | H → R in DD; learning difficulties. | VAR_008637 | |||||
| Natural variant | 975 | 1 | P → R in DD. | VAR_008638 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of cDNAs from human kidney coding for two alternatively spliced products of the cardiac Ca2+-ATPase gene." Lytton J., Maclennan D.H. J. Biol. Chem. 263:15024-15031(1988) [PubMed: 2844796] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS SERCA2A AND SERCA2B). Tissue: Kidney. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SERCA2B). Tissue: Eye. |
| [3] | "TRAM2 protein interacts with endoplasmic reticulum Ca2+ pump Serca2b and is necessary for collagen type I synthesis." Stefanovic B., Stefanovic L., Schnabl B., Bataller R., Brenner D.A. Mol. Cell. Biol. 24:1758-1768(2004) [PubMed: 14749390] [Abstract] Cited for: INTERACTION WITH TRAM2. |
| [4] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663, MASS SPECTROMETRY. Tissue: Epithelium. |
| [5] | "Detection of sequence-specific tyrosine nitration of manganese SOD and SERCA in cardiovascular disease and aging." Xu S., Ying J., Jiang B., Guo W., Adachi T., Sharov V., Lazar H., Menzoian J., Knyushko T.V., Bigelow D., Schoeneich C., Cohen R.A. Am. J. Physiol. 290:H2220-H2227(2006) [PubMed: 16399855] [Abstract] Cited for: NITRATION AT TYR-294 AND TYR-295. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663, MASS SPECTROMETRY. Tissue: Epithelium. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663, MASS SPECTROMETRY. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663, MASS SPECTROMETRY. |
| [9] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [10] | "The anti-apoptotic protein HAX-1 interacts with SERCA2 and regulates its protein levels to promote cell survival." Vafiadaki E., Arvanitis D.A., Pagakis S.N., Papalouka V., Sanoudou D., Kontrogianni-Konstantopoulos A., Kranias E.G. Mol. Biol. Cell 20:306-318(2009) [PubMed: 18971376] [Abstract] Cited for: INTERACTION WITH HAX1. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-663, MASS SPECTROMETRY. Tissue: T-cell. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-464, MASS SPECTROMETRY. |
| [13] | "Spectrum of novel ATP2A2 mutations in patients with Darier's disease." Sakuntabhai A., Burge S., Monk S., Hovnanian A. Hum. Mol. Genet. 8:1611-1619(1999) [PubMed: 10441323] [Abstract] Cited for: VARIANTS DD. |
| [14] | "ATP2A2 mutations in Darier's disease: variant cutaneous phenotypes are associated with missense mutations, but neuropsychiatric features are independent of mutation class." Ruiz-Perez V.L., Carter S.A., Healy E., Todd C., Rees J.L., Steijlen P.M., Carmichael A.J., Lewis H.M., Hohl D., Itin P., Vahlquist A., Gobello T., Mazzanti C., Reggazini R., Nagy G., Munro C.S., Strachan T. Hum. Mol. Genet. 8:1621-1630(1999) [PubMed: 10441324] [Abstract] Cited for: VARIANTS DD, TISSUE SPECIFICITY. |
| [15] | "ATP2A2 mutations in Darier's disease and their relationship to neuropsychiatric phenotypes." Jacobsen N.J.O., Lyons I., Hoogendoorn B., Burge S., Kwok P.-Y., O'Donovan M.C., Craddock N., Owen M.J. Hum. Mol. Genet. 8:1631-1636(1999) [PubMed: 10441325] [Abstract] Cited for: VARIANTS DD THR-39; ARG-560 AND LEU-765. |
| [16] | "Mutations in ATP2A2, encoding a Ca2+ pump, cause Darier disease." Sakuntabhai A., Ruiz-Perez V., Carter S., Jacobsen N., Burge S., Monk S., Smith M., Munro C.S., O'Donovan M.C., Craddock N., Kucherlapati R., Rees J.L., Owen M.J., Lathrop G.M., Monaco A.P., Strachan T., Hovnanian A. Nat. Genet. 21:271-277(1999) [PubMed: 10080178] [Abstract] Cited for: VARIANTS DD GLU-23; LYS-357; PHE-495 AND ARG-749. |
| [17] | "Acrokeratosis verruciformis of Hopf is caused by mutation in ATP2A2: evidence that it is allelic to Darier's disease." Dhitavat J., Macfarlane S., Dode L., Leslie N., Sakuntabhai A., MacSween R., Saihan E., Hovnanian A. J. Invest. Dermatol. 120:229-232(2003) [PubMed: 12542527] [Abstract] Cited for: VARIANT AKV LEU-602. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M23114 mRNA. Translation: AAA53193.1. M23116 Genomic DNA. Translation: AAA52757.1. M23115 mRNA. Translation: AAA53194.1. M23278, M23116 Genomic DNA. Translation: AAA52758.1. BC035588 mRNA. Translation: AAH35588.1. |
| IPI | IPI00177817. IPI00219078. |
| PIR | A31981. B31981. |
| RefSeq | NP_001129237.1. NP_001672.1. NP_733765.1. |
| UniGene | Hs.506759 |
3D structure databases | |
| SMR | P16615. Positions 1-992. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P16615. 9 interactions. |
| STRING | P16615. |
Protein family/group databases | |
| TCDB | 3.A.3.2.7. P-type ATPase (P-ATPase) superfamily. |
PTM databases | |
| PhosphoSite | P16615. |
2-D gel databases | |
| HSC-2DPAGE | P16614. |
Proteomic databases | |
| PRIDE | P16615. |
Genome annotation databases | |
| Ensembl | ENST00000313432; ENSP00000324892; ENSG00000174437; Homo sapiens. [Genome view] |
| GeneID | 488. |
| KEGG | hsa:488. |
| UCSC | uc001tqk.2. human. uc001tql.2. human. |
Organism-specific databases | |
| CTD | 488. |
| GeneCards | GC12P109182. |
| H-InvDB | HIX0010989. |
| HGNC | HGNC:812. ATP2A2. |
| MIM | 101900. phenotype. 108740. gene. 124200. phenotype. |
| Orphanet | 79151. Acrokeratosis verruciformis of Hopf. 218. Darier disease. |
| PharmGKB | PA71. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG08565. |
| HOGENOM | HBG456486. |
| HOVERGEN | P16615. |
| InParanoid | P16615. |
| OMA | PNKPSRT. |
| PhylomeDB | P16615. |
Enzyme and pathway databases | |
| BRENDA | 3.6.3.8. 247. |
Gene expression databases | |
| ArrayExpress | P16615. |
| Bgee | P16615. |
| CleanEx | HS_ATP2A2. |
| Genevestigator | P16615. |
| GermOnline | ENSG00000174437. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR000695. ATPase_P-typ_H-transp. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR005834. Dehalogen-like_hydro. [Graphical view] |
| PANTHER | PTHR11939. ATPase_P. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 4 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 2031. |
| SOURCE | Search... |
Entry information
| Entry name | AT2A2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P16615 Secondary accession number(s): P16614 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


