Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cysteine-rich secretory protein 2

Gene

CRISP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May regulate some ion channels' activity and therebye regulate calcium fluxes during sperm capacitation.By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine-rich secretory protein 2
Short name:
CRISP-2
Alternative name(s):
Cancer/testis antigen 36
Short name:
CT36
Testis-specific protein TPX-1
Gene namesi
Name:CRISP2
Synonyms:GAPDL5, TPX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:12024. CRISP2.

Subcellular locationi

GO - Cellular componenti

  • extracellular space Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36703.

Polymorphism and mutation databases

BioMutaiCRISP2.
DMDMi136111.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence analysisAdd
BLAST
Chaini22 – 243222Cysteine-rich secretory protein 2PRO_0000006264Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi189 ↔ 196PROSITE-ProRule annotation
Disulfide bondi192 ↔ 201PROSITE-ProRule annotation
Disulfide bondi205 ↔ 238PROSITE-ProRule annotation
Disulfide bondi214 ↔ 232PROSITE-ProRule annotation
Disulfide bondi223 ↔ 236PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiP16562.
PRIDEiP16562.

PTM databases

iPTMnetiP16562.
PhosphoSiteiP16562.

Expressioni

Tissue specificityi

Testis and epididymis.

Gene expression databases

BgeeiP16562.
CleanExiHS_CRISP2.
ExpressionAtlasiP16562. baseline and differential.
GenevisibleiP16562. HS.

Organism-specific databases

HPAiHPA031248.

Interactioni

Subunit structurei

Interacts with NSUN4 isoform 3.By similarity

Protein-protein interaction databases

BioGridi113032. 5 interactions.
STRINGi9606.ENSP00000339155.

Structurei

Secondary structure

1
243
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi210 – 2134Combined sources
Helixi214 – 2185Combined sources
Turni219 – 2213Combined sources
Beta strandi225 – 2306Combined sources
Helixi233 – 2364Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CQ7NMR-A204-239[»]
ProteinModelPortaliP16562.
SMRiP16562. Positions 37-242.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP16562.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini41 – 169129SCPAdd
BLAST
Domaini205 – 23834ShKTPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the CRISP family.Curated
Contains 1 SCP domain.Curated
Contains 1 ShKT domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3017. Eukaryota.
COG2340. LUCA.
GeneTreeiENSGT00760000119004.
HOGENOMiHOG000236338.
HOVERGENiHBG004184.
InParanoidiP16562.
KOiK19919.
OMAiREGINVW.
OrthoDBiEOG74R1RW.
TreeFamiTF316148.

Family and domain databases

Gene3Di3.40.33.10. 1 hit.
InterProiIPR001283. Allrgn_V5/Tpx1.
IPR018244. Allrgn_V5/Tpx1_CS.
IPR014044. CAP_domain.
IPR013871. Cysteine_rich_secretory.
IPR003582. ShKT_dom.
[Graphical view]
PANTHERiPTHR10334. PTHR10334. 1 hit.
PfamiPF00188. CAP. 1 hit.
PF08562. Crisp. 1 hit.
[Graphical view]
PRINTSiPR00837. V5TPXLIKE.
SMARTiSM00198. SCP. 1 hit.
[Graphical view]
SUPFAMiSSF55797. SSF55797. 1 hit.
PROSITEiPS01009. CRISP_1. 1 hit.
PS01010. CRISP_2. 1 hit.
PS51670. SHKT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P16562-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALLPVLFLV TVLLPSLPAE GKDPAFTALL TTQLQVQREI VNKHNELRKA
60 70 80 90 100
VSPPASNMLK MEWSREVTTN AQRWANKCTL QHSDPEDRKT STRCGENLYM
110 120 130 140 150
SSDPTSWSSA IQSWYDEILD FVYGVGPKSP NAVVGHYTQL VWYSTYQVGC
160 170 180 190 200
GIAYCPNQDS LKYYYVCQYC PAGNNMNRKN TPYQQGTPCA GCPDDCDKGL
210 220 230 240
CTNSCQYQDL LSNCDSLKNT AGCEHELLKE KCKATCLCEN KIY
Length:243
Mass (Da):27,259
Last modified:August 1, 1990 - v1
Checksum:iC5FE698C449CFAD9
GO
Isoform 2 (identifier: P16562-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-172: A → AMKTYLNKREGINVWKCFLRLRHFQLLRGEQLLTFS

Show »
Length:278
Mass (Da):31,581
Checksum:iD32D26D5E4FA370A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641S → C in BAF85074 (PubMed:14702039).Curated
Sequence conflicti88 – 881R → C in BAD97057 (Ref. 5) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti131 – 1311N → S.
Corresponds to variant rs34457011 [ dbSNP | Ensembl ].
VAR_048832

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei172 – 1721A → AMKTYLNKREGINVWKCFLR LRHFQLLRGEQLLTFS in isoform 2. 1 PublicationVSP_053891

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25532 mRNA. Translation: AAA61220.1.
X95239 mRNA. Translation: CAA64526.1.
AY289796 mRNA. Translation: AAP41200.1.
AY292862 mRNA. Translation: AAP44113.1.
AY292863 mRNA. Translation: AAP44114.1.
AY773479 mRNA. Translation: AAV48552.1.
AK292385 mRNA. Translation: BAF85074.1.
AK223337 mRNA. Translation: BAD97057.1.
AL121950 Genomic DNA. Translation: CAC10520.1.
CH471081 Genomic DNA. Translation: EAX04340.1.
CH471081 Genomic DNA. Translation: EAX04345.1.
BC022011 mRNA. Translation: AAH22011.1.
BC107707 mRNA. Translation: AAI07708.1.
CCDSiCCDS4928.1. [P16562-1]
PIRiB33329.
RefSeqiNP_001135879.1. NM_001142407.2. [P16562-1]
NP_001135880.1. NM_001142408.2. [P16562-1]
NP_001135889.1. NM_001142417.2. [P16562-1]
NP_001135907.1. NM_001142435.2. [P16562-1]
NP_001248751.1. NM_001261822.1. [P16562-1]
NP_003287.1. NM_003296.3. [P16562-1]
XP_005249406.1. XM_005249349.1. [P16562-2]
XP_005249407.1. XM_005249350.1. [P16562-2]
XP_005249408.1. XM_005249351.3. [P16562-2]
XP_005249409.1. XM_005249352.3. [P16562-2]
XP_005249410.1. XM_005249353.3. [P16562-2]
XP_005249411.1. XM_005249354.3. [P16562-2]
XP_005249413.1. XM_005249356.1. [P16562-2]
XP_005249414.1. XM_005249357.3. [P16562-2]
XP_005249415.1. XM_005249358.3. [P16562-1]
XP_011513143.1. XM_011514841.1. [P16562-2]
XP_011513144.1. XM_011514842.1. [P16562-2]
UniGeneiHs.2042.

Genome annotation databases

EnsembliENST00000339139; ENSP00000339155; ENSG00000124490. [P16562-1]
ENST00000616725; ENSP00000484609; ENSG00000124490. [P16562-1]
ENST00000618917; ENSP00000482890; ENSG00000124490. [P16562-2]
GeneIDi7180.
KEGGihsa:7180.
UCSCiuc003ozl.4. human. [P16562-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25532 mRNA. Translation: AAA61220.1.
X95239 mRNA. Translation: CAA64526.1.
AY289796 mRNA. Translation: AAP41200.1.
AY292862 mRNA. Translation: AAP44113.1.
AY292863 mRNA. Translation: AAP44114.1.
AY773479 mRNA. Translation: AAV48552.1.
AK292385 mRNA. Translation: BAF85074.1.
AK223337 mRNA. Translation: BAD97057.1.
AL121950 Genomic DNA. Translation: CAC10520.1.
CH471081 Genomic DNA. Translation: EAX04340.1.
CH471081 Genomic DNA. Translation: EAX04345.1.
BC022011 mRNA. Translation: AAH22011.1.
BC107707 mRNA. Translation: AAI07708.1.
CCDSiCCDS4928.1. [P16562-1]
PIRiB33329.
RefSeqiNP_001135879.1. NM_001142407.2. [P16562-1]
NP_001135880.1. NM_001142408.2. [P16562-1]
NP_001135889.1. NM_001142417.2. [P16562-1]
NP_001135907.1. NM_001142435.2. [P16562-1]
NP_001248751.1. NM_001261822.1. [P16562-1]
NP_003287.1. NM_003296.3. [P16562-1]
XP_005249406.1. XM_005249349.1. [P16562-2]
XP_005249407.1. XM_005249350.1. [P16562-2]
XP_005249408.1. XM_005249351.3. [P16562-2]
XP_005249409.1. XM_005249352.3. [P16562-2]
XP_005249410.1. XM_005249353.3. [P16562-2]
XP_005249411.1. XM_005249354.3. [P16562-2]
XP_005249413.1. XM_005249356.1. [P16562-2]
XP_005249414.1. XM_005249357.3. [P16562-2]
XP_005249415.1. XM_005249358.3. [P16562-1]
XP_011513143.1. XM_011514841.1. [P16562-2]
XP_011513144.1. XM_011514842.1. [P16562-2]
UniGeneiHs.2042.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2CQ7NMR-A204-239[»]
ProteinModelPortaliP16562.
SMRiP16562. Positions 37-242.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113032. 5 interactions.
STRINGi9606.ENSP00000339155.

PTM databases

iPTMnetiP16562.
PhosphoSiteiP16562.

Polymorphism and mutation databases

BioMutaiCRISP2.
DMDMi136111.

Proteomic databases

PaxDbiP16562.
PRIDEiP16562.

Protocols and materials databases

DNASUi7180.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339139; ENSP00000339155; ENSG00000124490. [P16562-1]
ENST00000616725; ENSP00000484609; ENSG00000124490. [P16562-1]
ENST00000618917; ENSP00000482890; ENSG00000124490. [P16562-2]
GeneIDi7180.
KEGGihsa:7180.
UCSCiuc003ozl.4. human. [P16562-1]

Organism-specific databases

CTDi7180.
GeneCardsiCRISP2.
H-InvDBHIX0165001.
HGNCiHGNC:12024. CRISP2.
HPAiHPA031248.
MIMi187430. gene.
neXtProtiNX_P16562.
PharmGKBiPA36703.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3017. Eukaryota.
COG2340. LUCA.
GeneTreeiENSGT00760000119004.
HOGENOMiHOG000236338.
HOVERGENiHBG004184.
InParanoidiP16562.
KOiK19919.
OMAiREGINVW.
OrthoDBiEOG74R1RW.
TreeFamiTF316148.

Miscellaneous databases

EvolutionaryTraceiP16562.
GeneWikiiCRISP2.
GenomeRNAii7180.
PROiP16562.
SOURCEiSearch...

Gene expression databases

BgeeiP16562.
CleanExiHS_CRISP2.
ExpressionAtlasiP16562. baseline and differential.
GenevisibleiP16562. HS.

Family and domain databases

Gene3Di3.40.33.10. 1 hit.
InterProiIPR001283. Allrgn_V5/Tpx1.
IPR018244. Allrgn_V5/Tpx1_CS.
IPR014044. CAP_domain.
IPR013871. Cysteine_rich_secretory.
IPR003582. ShKT_dom.
[Graphical view]
PANTHERiPTHR10334. PTHR10334. 1 hit.
PfamiPF00188. CAP. 1 hit.
PF08562. Crisp. 1 hit.
[Graphical view]
PRINTSiPR00837. V5TPXLIKE.
SMARTiSM00198. SCP. 1 hit.
[Graphical view]
SUPFAMiSSF55797. SSF55797. 1 hit.
PROSITEiPS01009. CRISP_1. 1 hit.
PS01010. CRISP_2. 1 hit.
PS51670. SHKT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and mapping of a testis-specific gene with sequence similarity to a sperm-coating glycoprotein gene."
    Kasahara M., Gutknecht J., Brew K., Spurr N., Goodfellow P.N.
    Genomics 5:527-534(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "The human cysteine-rich secretory protein (CRISP) family. Primary structure and tissue distribution of CRISP-1, CRISP-2 and CRISP-3."
    Kraetzschmar J., Haendler B., Eberspaecher U., Roostermann D., Donner P., Schleuning W.-D.
    Eur. J. Biochem. 236:827-836(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  3. "Cloning of an isoform of TPX-1 gene related to spermatogenesis."
    Sha J.H., Zhou Z.M., Li J.M.
    Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING.
    Tissue: Testis.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  5. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  9. "Solution structure of RSGI RUH-032, a cysteine-rich domain of CRISP-2 from human."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 204-239.

Entry informationi

Entry nameiCRIS2_HUMAN
AccessioniPrimary (citable) accession number: P16562
Secondary accession number(s): A8K8M0
, Q53FF2, Q5U8Z9, Q7Z7B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: August 1, 1990
Last modified: June 8, 2016
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.