Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cysteine-rich secretory protein 2

Gene

CRISP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May regulate some ion channels' activity and therebye regulate calcium fluxes during sperm capacitation.By similarity

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000124490-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine-rich secretory protein 2
Short name:
CRISP-2
Alternative name(s):
Cancer/testis antigen 36
Short name:
CT36
Testis-specific protein TPX-1
Gene namesi
Name:CRISP2
Synonyms:GAPDL5, TPX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:12024. CRISP2.

Subcellular locationi

GO - Cellular componenti

  • extracellular space Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi7180.
OpenTargetsiENSG00000124490.
PharmGKBiPA36703.

Polymorphism and mutation databases

BioMutaiCRISP2.
DMDMi136111.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000000626422 – 243Cysteine-rich secretory protein 2Add BLAST222

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi189 ↔ 196PROSITE-ProRule annotation
Disulfide bondi192 ↔ 201PROSITE-ProRule annotation
Disulfide bondi205 ↔ 238PROSITE-ProRule annotation
Disulfide bondi214 ↔ 232PROSITE-ProRule annotation
Disulfide bondi223 ↔ 236PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiP16562.
PeptideAtlasiP16562.
PRIDEiP16562.

PTM databases

iPTMnetiP16562.
PhosphoSitePlusiP16562.

Expressioni

Tissue specificityi

Testis and epididymis.

Gene expression databases

BgeeiENSG00000124490.
CleanExiHS_CRISP2.
ExpressionAtlasiP16562. baseline and differential.
GenevisibleiP16562. HS.

Organism-specific databases

HPAiHPA031248.

Interactioni

Subunit structurei

Interacts with NSUN4 isoform 3.By similarity

Protein-protein interaction databases

BioGridi113032. 5 interactors.
STRINGi9606.ENSP00000339155.

Structurei

Secondary structure

1243
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi210 – 213Combined sources4
Helixi214 – 218Combined sources5
Turni219 – 221Combined sources3
Beta strandi225 – 230Combined sources6
Helixi233 – 236Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CQ7NMR-A204-239[»]
ProteinModelPortaliP16562.
SMRiP16562.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP16562.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini41 – 169SCPAdd BLAST129
Domaini205 – 238ShKTPROSITE-ProRule annotationAdd BLAST34

Sequence similaritiesi

Belongs to the CRISP family.Curated
Contains 1 SCP domain.Curated
Contains 1 ShKT domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3017. Eukaryota.
COG2340. LUCA.
GeneTreeiENSGT00760000119004.
HOGENOMiHOG000236338.
HOVERGENiHBG004184.
InParanoidiP16562.
KOiK19919.
OMAiREGINVW.
OrthoDBiEOG091G0D4V.
TreeFamiTF316148.

Family and domain databases

Gene3Di3.40.33.10. 1 hit.
InterProiIPR001283. Allrgn_V5/Tpx1.
IPR018244. Allrgn_V5/Tpx1_CS.
IPR014044. CAP_domain.
IPR013871. Cysteine_rich_secretory.
IPR003582. ShKT_dom.
[Graphical view]
PANTHERiPTHR10334. PTHR10334. 1 hit.
PfamiPF00188. CAP. 1 hit.
PF08562. Crisp. 1 hit.
[Graphical view]
PRINTSiPR00837. V5TPXLIKE.
SMARTiSM00198. SCP. 1 hit.
[Graphical view]
SUPFAMiSSF55797. SSF55797. 1 hit.
PROSITEiPS01009. CRISP_1. 1 hit.
PS01010. CRISP_2. 1 hit.
PS51670. SHKT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P16562-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALLPVLFLV TVLLPSLPAE GKDPAFTALL TTQLQVQREI VNKHNELRKA
60 70 80 90 100
VSPPASNMLK MEWSREVTTN AQRWANKCTL QHSDPEDRKT STRCGENLYM
110 120 130 140 150
SSDPTSWSSA IQSWYDEILD FVYGVGPKSP NAVVGHYTQL VWYSTYQVGC
160 170 180 190 200
GIAYCPNQDS LKYYYVCQYC PAGNNMNRKN TPYQQGTPCA GCPDDCDKGL
210 220 230 240
CTNSCQYQDL LSNCDSLKNT AGCEHELLKE KCKATCLCEN KIY
Length:243
Mass (Da):27,259
Last modified:August 1, 1990 - v1
Checksum:iC5FE698C449CFAD9
GO
Isoform 2 (identifier: P16562-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-172: A → AMKTYLNKREGINVWKCFLRLRHFQLLRGEQLLTFS

Show »
Length:278
Mass (Da):31,581
Checksum:iD32D26D5E4FA370A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64S → C in BAF85074 (PubMed:14702039).Curated1
Sequence conflicti88R → C in BAD97057 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048832131N → S.Corresponds to variant rs34457011dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053891172A → AMKTYLNKREGINVWKCFLR LRHFQLLRGEQLLTFS in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25532 mRNA. Translation: AAA61220.1.
X95239 mRNA. Translation: CAA64526.1.
AY289796 mRNA. Translation: AAP41200.1.
AY292862 mRNA. Translation: AAP44113.1.
AY292863 mRNA. Translation: AAP44114.1.
AY773479 mRNA. Translation: AAV48552.1.
AK292385 mRNA. Translation: BAF85074.1.
AK223337 mRNA. Translation: BAD97057.1.
AL121950 Genomic DNA. Translation: CAC10520.1.
CH471081 Genomic DNA. Translation: EAX04340.1.
CH471081 Genomic DNA. Translation: EAX04345.1.
BC022011 mRNA. Translation: AAH22011.1.
BC107707 mRNA. Translation: AAI07708.1.
CCDSiCCDS4928.1. [P16562-1]
PIRiB33329.
RefSeqiNP_001135879.1. NM_001142407.2. [P16562-1]
NP_001135880.1. NM_001142408.2. [P16562-1]
NP_001135889.1. NM_001142417.2. [P16562-1]
NP_001135907.1. NM_001142435.2. [P16562-1]
NP_001248751.1. NM_001261822.1. [P16562-1]
NP_003287.1. NM_003296.3. [P16562-1]
XP_005249406.1. XM_005249349.1. [P16562-2]
XP_005249407.1. XM_005249350.1. [P16562-2]
XP_005249408.1. XM_005249351.3. [P16562-2]
XP_005249409.1. XM_005249352.3. [P16562-2]
XP_005249410.1. XM_005249353.3. [P16562-2]
XP_005249413.1. XM_005249356.1. [P16562-2]
XP_011513143.1. XM_011514841.1. [P16562-2]
XP_011513144.1. XM_011514842.1. [P16562-2]
UniGeneiHs.2042.

Genome annotation databases

EnsembliENST00000339139; ENSP00000339155; ENSG00000124490. [P16562-1]
ENST00000616725; ENSP00000484609; ENSG00000124490. [P16562-1]
ENST00000618917; ENSP00000482890; ENSG00000124490. [P16562-2]
GeneIDi7180.
KEGGihsa:7180.
UCSCiuc003ozl.4. human. [P16562-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M25532 mRNA. Translation: AAA61220.1.
X95239 mRNA. Translation: CAA64526.1.
AY289796 mRNA. Translation: AAP41200.1.
AY292862 mRNA. Translation: AAP44113.1.
AY292863 mRNA. Translation: AAP44114.1.
AY773479 mRNA. Translation: AAV48552.1.
AK292385 mRNA. Translation: BAF85074.1.
AK223337 mRNA. Translation: BAD97057.1.
AL121950 Genomic DNA. Translation: CAC10520.1.
CH471081 Genomic DNA. Translation: EAX04340.1.
CH471081 Genomic DNA. Translation: EAX04345.1.
BC022011 mRNA. Translation: AAH22011.1.
BC107707 mRNA. Translation: AAI07708.1.
CCDSiCCDS4928.1. [P16562-1]
PIRiB33329.
RefSeqiNP_001135879.1. NM_001142407.2. [P16562-1]
NP_001135880.1. NM_001142408.2. [P16562-1]
NP_001135889.1. NM_001142417.2. [P16562-1]
NP_001135907.1. NM_001142435.2. [P16562-1]
NP_001248751.1. NM_001261822.1. [P16562-1]
NP_003287.1. NM_003296.3. [P16562-1]
XP_005249406.1. XM_005249349.1. [P16562-2]
XP_005249407.1. XM_005249350.1. [P16562-2]
XP_005249408.1. XM_005249351.3. [P16562-2]
XP_005249409.1. XM_005249352.3. [P16562-2]
XP_005249410.1. XM_005249353.3. [P16562-2]
XP_005249413.1. XM_005249356.1. [P16562-2]
XP_011513143.1. XM_011514841.1. [P16562-2]
XP_011513144.1. XM_011514842.1. [P16562-2]
UniGeneiHs.2042.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CQ7NMR-A204-239[»]
ProteinModelPortaliP16562.
SMRiP16562.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113032. 5 interactors.
STRINGi9606.ENSP00000339155.

PTM databases

iPTMnetiP16562.
PhosphoSitePlusiP16562.

Polymorphism and mutation databases

BioMutaiCRISP2.
DMDMi136111.

Proteomic databases

PaxDbiP16562.
PeptideAtlasiP16562.
PRIDEiP16562.

Protocols and materials databases

DNASUi7180.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339139; ENSP00000339155; ENSG00000124490. [P16562-1]
ENST00000616725; ENSP00000484609; ENSG00000124490. [P16562-1]
ENST00000618917; ENSP00000482890; ENSG00000124490. [P16562-2]
GeneIDi7180.
KEGGihsa:7180.
UCSCiuc003ozl.4. human. [P16562-1]

Organism-specific databases

CTDi7180.
DisGeNETi7180.
GeneCardsiCRISP2.
H-InvDBHIX0165001.
HGNCiHGNC:12024. CRISP2.
HPAiHPA031248.
MIMi187430. gene.
neXtProtiNX_P16562.
OpenTargetsiENSG00000124490.
PharmGKBiPA36703.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3017. Eukaryota.
COG2340. LUCA.
GeneTreeiENSGT00760000119004.
HOGENOMiHOG000236338.
HOVERGENiHBG004184.
InParanoidiP16562.
KOiK19919.
OMAiREGINVW.
OrthoDBiEOG091G0D4V.
TreeFamiTF316148.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000124490-MONOMER.

Miscellaneous databases

EvolutionaryTraceiP16562.
GeneWikiiCRISP2.
GenomeRNAii7180.
PROiP16562.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124490.
CleanExiHS_CRISP2.
ExpressionAtlasiP16562. baseline and differential.
GenevisibleiP16562. HS.

Family and domain databases

Gene3Di3.40.33.10. 1 hit.
InterProiIPR001283. Allrgn_V5/Tpx1.
IPR018244. Allrgn_V5/Tpx1_CS.
IPR014044. CAP_domain.
IPR013871. Cysteine_rich_secretory.
IPR003582. ShKT_dom.
[Graphical view]
PANTHERiPTHR10334. PTHR10334. 1 hit.
PfamiPF00188. CAP. 1 hit.
PF08562. Crisp. 1 hit.
[Graphical view]
PRINTSiPR00837. V5TPXLIKE.
SMARTiSM00198. SCP. 1 hit.
[Graphical view]
SUPFAMiSSF55797. SSF55797. 1 hit.
PROSITEiPS01009. CRISP_1. 1 hit.
PS01010. CRISP_2. 1 hit.
PS51670. SHKT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCRIS2_HUMAN
AccessioniPrimary (citable) accession number: P16562
Secondary accession number(s): A8K8M0
, Q53FF2, Q5U8Z9, Q7Z7B2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 1, 1990
Last sequence update: August 1, 1990
Last modified: November 2, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.