P16452 (EPB42_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 146.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Erythrocyte membrane protein band 4.2 Short name=Erythrocyte protein 4.2 Short name=P4.2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 691 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probably plays an important role in the regulation of erythrocyte shape and mechanical properties. |
| Subunit structure | Oligomer. Interacts with the cytoplasmic domain of SLC4A1/band 3 anion transport protein. |
| Subcellular location | Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm › cytoskeleton. Note: Cytoplasmic surface of erythrocyte membranes. |
| Post-translational modification | Both cAMP-dependent kinase (CAPK) and another kinase present in the red-blood cells seem to be able to phosphorylate EPB42. |
| Involvement in disease | Spherocytosis 5 (SPH5) [MIM:612690]: Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Absence of band 4.2 associated with spur or target erythrocytes has also been reported. |
| Miscellaneous | The substitution of an Ala for a Cys in the active site may be responsible for the lack of transglutaminase activity of band 4.2. |
| Sequence similarities | Belongs to the transglutaminase superfamily. Transglutaminase family. |
| Sequence caution | The sequence AAA36401.1 differs from that shown. Reason: Frameshift at positions 335 and 340. The sequence AAA36402.1 differs from that shown. Reason: Frameshift at positions 335 and 340. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SPINK7 | P58062 | 3 | EBI-1182496,EBI-1182445 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Short (identifier: P16452-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform Long (identifier: P16452-2) The sequence of this isoform differs from the canonical sequence as follows: 3-3: Q → QGEPSQRSTGLAGLYAAPAASPVFIKGSGMD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 691 | 691 | Erythrocyte membrane protein band 4.2 | PRO_0000213720 | |||||
Regions | |||||||||
| Region | 31 – 39 | 9 | Band 3 binding By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 248 | 1 | Phosphoserine; by PKA Probable | ||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 3 | 1 | Q → QGEPSQRSTGLAGLYAAPAA SPVFIKGSGMD in isoform Long. | VSP_006416 | |||||
| Natural variant | 112 | 1 | A → T in SPH5; Nippon/Fukuoka. Ref.9 Ref.10 Ref.12 Ref.14 Corresponds to variant rs28933988 [ dbSNP | Ensembl ]. | VAR_007482 | |||||
| Natural variant | 145 | 1 | D → Y in SPH5; Komatsu. Ref.13 | VAR_058099 | |||||
| Natural variant | 280 | 1 | R → Q in SPH5; Tozeur. Ref.11 | VAR_012268 | |||||
| Natural variant | 287 | 1 | R → C in SPH5; Shiga. Ref.12 | VAR_058100 | |||||
Experimental info | |||||||||
| Sequence conflict | 350 | 1 | H → D in AAA74589. Ref.1 | ||||||
| Sequence conflict | 350 | 1 | H → D in AAA52385. Ref.1 | ||||||
| Sequence conflict | 350 | 1 | H → D in AAA35798. Ref.2 | ||||||
| Sequence conflict | 376 | 1 | L → V in AAA74589. Ref.1 | ||||||
| Sequence conflict | 376 | 1 | L → V in AAA52385. Ref.1 | ||||||
| Sequence conflict | 376 | 1 | L → V in AAA35798. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Organization of the gene for human erythrocyte membrane protein 4.2: structural similarities with the gene for the a subunit of factor XIII." Korsgren C., Cohen C.M. Proc. Natl. Acad. Sci. U.S.A. 88:4840-4844(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG). Tissue: Reticulocyte. |
| [2] | "Complete amino acid sequence and homologies of human erythrocyte membrane protein band 4.2." Korsgren C., Lawler J., Lambert S., Speicher D., Cohen C.M. Proc. Natl. Acad. Sci. U.S.A. 87:613-617(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE (ISOFORM SHORT). Tissue: Reticulocyte. |
| [3] | "Molecular cloning of human protein 4.2: a major component of the erythrocyte membrane." Sung L.A., Chien S., Chang L.-S., Lambert K., Bliss S.A., Bouhassira E.E., Nagel R.L., Schwartz R.S., Rybicki A.C. Proc. Natl. Acad. Sci. U.S.A. 87:955-959(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). Tissue: Reticulocyte. |
| [4] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). |
| [7] | "Human erythrocyte protein 4.2, a high copy number membrane protein, is N-myristylated." Risinger M.A., Dotimas E.M., Cohen C.M. J. Biol. Chem. 267:5680-5685(1992) [PubMed] [Europe PMC] [Abstract] Cited for: MYRISTOYLATION AT GLY-2. |
| [8] | "Structural domain mapping and phosphorylation of human erythrocyte pallidin (band 4.2)." Dotimas E., Speicher D.W., Guptaroy B., Cohen C.M. Biochim. Biophys. Acta 1148:19-29(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-248. |
| [9] | "An alanine-to-threonine substitution in protein 4.2 cDNA is associated with a Japanese form of hereditary hemolytic anemia (protein 4.2 Nippon)." Bouhassira E.E., Schwartz R.S., Yawata Y., Ata K., Kanzaki A., Qiu J.J.-H., Nagel R.L., Rybicki A.C. Blood 79:1846-1854(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPH5 THR-112. |
| [10] | "A novel mutation in the erythrocyte protein 4.2 gene of Japanese patients with hereditary spherocytosis (protein 4.2 Fukuoka)." Takaoka Y., Ideguchi H., Matsuda M., Sakamoto N., Takeuchi T., Fukumaki Y. Br. J. Haematol. 88:527-533(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPH5 THR-112. |
| [11] | "A point mutation in the protein 4.2 gene (allele 4.2 Tozeur) associated with hereditary haemolytic anaemia." Hayette S., Morle L., Bozon M., Ghanem A., Risinger M., Korsgren C., Tanner M.J.A., Fattoum S., Cohen C.M., Delaunay J. Br. J. Haematol. 89:762-770(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPH5 GLN-280. |
| [12] | "Band 4.2 Shiga: 317 CGC-->TGC in compound heterozygotes with 142 GCT-->ACT results in band 4.2 deficiency and microspherocytosis." Kanzaki A., Yasunaga M., Okamoto N., Inoue T., Yawata A., Wada H., Andoh A., Hodohara K., Fujiyama Y., Bamba T., Harano T., Harano K., Yawata Y. Br. J. Haematol. 91:333-340(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SPH5 THR-112 AND CYS-287. |
| [13] | "Band 4.2 Komatsu: 523 GAT-->TAT (175 Asp-->Tyr) in exon 4 of the band 4.2 gene associated with total deficiency of band 4.2, hemolytic anemia with ovalostomatocytosis and marked disruption of the cytoskeletal network." Kanzaki A., Yawata Y., Yawata A., Inoue T., Okamoto N., Wada H., Harano T., Harano K., Wilmotte R., Hayette S., Nakamura Y., Niki T., Kawamura Y., Nakamura S., Matsuda T. Int. J. Hematol. 61:165-178(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPH5 TYR-145. |
| [14] | "4.2 Nippon mutation in a non-Japanese patient with hereditary spherocytosis." Perrotta S., Iolascon A., Polito R., d'Urzo G., Conte M.L., Miraglia del Giudice E. Haematologica 84:660-662(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPH5 THR-112. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M60298 mRNA. Translation: AAA74589.1. L06519 L06518 Genomic DNA. Translation: AAA52385.1.M29399 mRNA. Translation: AAA35798.1. M30647 mRNA. Translation: AAA36401.1. Frameshift. M30646 mRNA. Translation: AAA36402.1. Frameshift. AC068724 Genomic DNA. No translation available. CH471125 Genomic DNA. Translation: EAW92591.1. BC096093 mRNA. Translation: AAH96093.1. BC096094 mRNA. Translation: AAH96094.1. |
| IPI | IPI00028120. IPI00827872. |
| PIR | A39707. |
| RefSeq | NP_000110.2. NM_000119.2. NP_001107606.1. NM_001114134.1. |
| UniGene | Hs.368642. |
3D structure databases | |
| ProteinModelPortal | P16452. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P16452. 3 interactions. |
| STRING | 9606.ENSP00000300215. |
PTM databases | |
| PhosphoSite | P16452. |
Polymorphism databases | |
| DMDM | 215274164. |
Proteomic databases | |
| PaxDb | P16452. |
| PRIDE | P16452. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000300215; ENSP00000300215; ENSG00000166947. ENST00000441366; ENSP00000396616; ENSG00000166947. |
| GeneID | 2038. |
| KEGG | hsa:2038. |
| UCSC | uc001zqz.4. human. uc001zrb.4. human. |
Organism-specific databases | |
| CTD | 2038. |
| GeneCards | GC15M043398. |
| HGNC | HGNC:3381. EPB42. |
| HPA | HPA040261. |
| MIM | 177070. gene. 612690. phenotype. |
| neXtProt | NX_P16452. |
| Orphanet | 822. Hereditary spherocytosis. |
| PharmGKB | PA27814. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG87163. |
| HOGENOM | HOG000231695. |
| HOVERGEN | HBG106048. |
| InParanoid | P16452. |
| OMA | PPENSFL. |
Gene expression databases | |
| ArrayExpress | P16452. |
| Bgee | P16452. |
| CleanEx | HS_EPB42. |
| Genevestigator | P16452. |
| GermOnline | ENSG00000166947. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 3 hits. |
| InterPro | IPR023608. Gln_gamma-glutamylTfrase_euk. IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002931. Transglutaminase-like. IPR008958. Transglutaminase_C. IPR013808. Transglutaminase_CS. IPR001102. Transglutaminase_N. [Graphical view] |
| PANTHER | PTHR11590. PTHR11590. 1 hit. |
| Pfam | PF00927. Transglut_C. 2 hits. PF01841. Transglut_core. 1 hit. PF00868. Transglut_N. 1 hit. [Graphical view] |
| PIRSF | PIRSF000459. TGM_EBP42. 1 hit. |
| SMART | SM00460. TGc. 1 hit. [Graphical view] |
| SUPFAM | SSF81296. Ig_E-set. 1 hit. SSF49309. Transglut_C. 2 hits. |
| PROSITE | PS00547. TRANSGLUTAMINASES. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 2038. |
| NextBio | 8277. |
| SOURCE | Search... |
Entry information
| Entry name | EPB42_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P16452 Secondary accession number(s): Q4VB97 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
