P16422 P18180 Q6FG26 Q6FG49 Q96C47 Q9UCD0 EPCAM_HUMAN Epithelial cell adhesion molecule Ep-CAM Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein EGP Epithelial glycoprotein 314 EGP314 hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD326 EPCAM GA733-2 M1S2 M4S1 MIC18 TACSTD1 TROP1 Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Molecular cloning and characterization of a human adenocarcinoma/epithelial cell surface antigen complementary DNA. NUCLEOTIDE SEQUENCE [MRNA] VARIANT THR-115 Lung adenocarcinoma Isolation and characterization of a cDNA encoding the KS1/4 epithelial carcinoma marker. NUCLEOTIDE SEQUENCE [MRNA] VARIANT THR-115 Epithelial glycoprotein is a member of a family of epithelial cell surface antigens homologous to nidogen, a matrix adhesion protein. NUCLEOTIDE SEQUENCE [MRNA] VARIANT THR-115 Molecular cloning of cDNA for the carcinoma-associated antigen GA733-2. NUCLEOTIDE SEQUENCE [MRNA] Colon carcinoma Retroposition in a family of carcinoma-associated antigen genes. NUCLEOTIDE SEQUENCE [GENOMIC DNA] Lymphoma Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Generation and annotation of the DNA sequences of human chromosomes 2 and 4. NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] VARIANT THR-115 Ovary Sequence investigation of the major gastrointestinal tumor-associated antigen gene family, GA733. PRELIMINARY PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 81-126 Placenta Isolation, partial characterization, and molecular cloning of a human colon adenocarcinoma cell-surface glycoprotein recognized by the C215 mouse monoclonal antibody. PROTEIN SEQUENCE OF 82-100 SUBUNIT Determination of disulfide bond assignments and N-glycosylation sites of the human gastrointestinal carcinoma antigen GA733-2 (CO17-1A, EGP, KS1-4, KSA, and Ep-CAM). DISULFIDE BONDS GLYCOSYLATION AT ASN-74 AND ASN-111 The carcinoma-associated antigen EpCAM upregulates c-myc and induces cell proliferation. FUNCTION SUBCELLULAR LOCATION The tumour-associated antigen EpCAM upregulates the fatty acid binding protein E-FABP. FUNCTION The cell-cell adhesion molecule EpCAM interacts directly with the tight junction protein claudin-7. SUBCELLULAR LOCATION INTERACTION WITH CLDN7 Glycosylation is crucial for stability of tumour and cancer stem cell antigen EpCAM. GLYCOSYLATION AT ASN-74; ASN-111 AND ASN-198 MUTAGENESIS OF ASN-74; ASN-111 AND ASN-198 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-198 MASS SPECTROMETRY Liver Heritable somatic methylation and inactivation of MSH2 in families with Lynch syndrome due to deletion of the 3' exons of TACSTD1. INVOLVEMENT IN HNPCC8 Epithelial cell adhesion molecule regulation is associated with the maintenance of the undifferentiated phenotype of human embryonic stem cells. FUNCTION TISSUE SPECIFICITY Characterization of epithelial cell adhesion molecule as a surface marker on undifferentiated human embryonic stem cells. FUNCTION SUBCELLULAR LOCATION Initial characterization of the human central proteome. IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS] Identification of EpCAM as the gene for congenital tufting enteropathy. VARIANT DIAR5 TYR-66 May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. Monomer. Interacts with phosphorylated CLDN7. Lateral cell membrane Single-pass type I membrane protein Cell junction Tight junction Co-localizes with CLDN7 at the lateral cell membrane and tight junction. Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma. Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability. Diarrhea 5, with tufting enteropathy, congenital (DIAR5) [MIM:613217]: An intractable diarrhea of infancy characterized by villous atrophy and absence of inflammation, with intestinal epithelial cell dysplasia manifesting as focal epithelial tufts in the duodenum and jejunum. Note=The disease is caused by mutations affecting the gene represented in this entry. Hereditary non-polyposis colorectal cancer 8 (HNPCC8) [MIM:613244]: An autosomal dominant disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early-onset colorectal carcinoma (CRC) and extra-colonic tumors of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world. Clinically, HNPCC is often divided into two subgroups. Type I is characterized by hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II is characterized by increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. Note=The disease is caused by mutations affecting the gene represented in this entry. HNPCC8 results from heterozygous deletion of 3-prime exons of EPCAM and intergenic regions directly upstream of MSH2, resulting in transcriptional read-through and epigenetic silencing of MSH2 in tissues expressing EPCAM. Belongs to the EPCAM family. Contains 1 thyroglobulin type-1 domain. Cell junction Cell membrane Complete proteome Direct protein sequencing Disease mutation Disulfide bond Glycoprotein Hereditary nonpolyposis colorectal cancer Membrane Polymorphism Pyrrolidone carboxylic acid Reference proteome Repeat Signal Tight junction Transmembrane Transmembrane helix Tumor antigen C Y M T N A N A N A I M K R MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA EIKEMGEMHRELNA Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License