Reviewed,
UniProtKB/Swiss-Prot P16278 (BGAL_HUMAN)
Last modified
February 9, 2010.
Version 119.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Beta-galactosidase EC=3.2.1.23 Alternative name(s): Acid beta-galactosidase Short name=Lactase Elastin receptor 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 677 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cleaves beta-linked terminal galactosyl residues from gangliosides, glycoproteins, and glycosaminoglycans. Ref.9 Isoform 2 has no beta-galactosidase catalytic activity, but plays functional roles in the formation of extracellular elastic fibers (elastogenesis) and in the development of connective tissue. Seems to be identical to the elastin-binding protein (EBP), a major component of the non-integrin cell surface receptor expressed on fibroblasts, smooth muscle cells, chondroblasts, leukocytes, and certain cancer cell types. In elastin producing cells, associates with tropoelastin intracellularly and functions as a recycling molecular chaperone which facilitates the secretions of tropoelastin and its assembly into elastic fibers. Ref.9 |
| Catalytic activity | Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides. |
| Subcellular location | Isoform 1: Lysosome. Isoform 2: Cytoplasm › perinuclear region. Note: Localized to the perinuclear area of the cytoplasm but not to lysosomes. |
| Involvement in disease | Defects in GLB1 are the cause of GM1-gangliosidosis type 1 (GM1G1) [MIM:230500]; also known as infantile GM1-gangliosidosis. GM1-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM1 gangliosides, glycoproteins and keratan sulfate primarily in neurons of the central nervous system. GM1G1 is characterized by onset within the first three months of life, central nervous system degeneration, coarse facial features, hepatosplenomegaly, skeletal dysmorphology reminiscent of Hurler syndrome, and rapidly progressive psychomotor deterioration. Urinary oligosaccharide levels are high. It leads to death usually between the first and second year of life. Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.22 Ref.25 Ref.28 Ref.29 Ref.30 Ref.33 Ref.35 Ref.40 Defects in GLB1 are the cause of GM1-gangliosidosis type 2 (GM1G2) [MIM:230600]; also known as late infantile/juvenile GM1-gangliosidosis. GM1G2 is characterized by onset between ages 1 and 5. The main symptom is locomotor ataxia, ultimately leading to a state of decerebration with epileptic seizures. Patients do not display the skeletal changes associated with the infantile form, but they nonetheless excrete elevated amounts of beta-linked galactose-terminal oligosaccharides. Inheritance is autosomal recessive. Defects in GLB1 are the cause of GM1-gangliosidosis type 3 (GM1G3) [MIM:230650]; also known as adult or chronic GM1-gangliosidosis. GM1G3 is characterized by a variable phenotype. Patients show mild skeletal abnormalities, dysarthria, gait disturbance, dystonia and visual impairment. Visceromegaly is absent. Intellectual deficit can initially be mild or absent but progresses over time. Inheritance is autosomal recessive. Defects in GLB1 are the cause of mucopolysaccharidosis type 4B (MPS4B) [MIM:253010]; also known as Morquio syndrome B. MPS4B is a form of mucopolysaccharidosis type 4, an autosomal recessive lysosomal storage disease characterized by intracellular accumulation of keratan sulfate and chondroitin-6-sulfate. Key clinical features include short stature, skeletal dysplasia, dental anomalies, and corneal clouding. Intelligence is normal and there is no direct central nervous system involvement, although the skeletal changes may result in neurologic complications. There is variable severity, but patients with the severe phenotype usually do not survive past the second or third decade of life. Ref.16 Ref.31 Ref.23 Ref.27 |
| Sequence similarities | Belongs to the glycosyl hydrolase 35 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Lysosome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Gangliosidosis |
| Domain | Signal |
| Molecular function | Glycosidase Hydrolase |
| PTM | Glycoprotein Zymogen |
| Technical term | Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | carbohydrate metabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular component | lysosome Inferred from electronic annotation. Source: UniProtKB-SubCell perinuclear region of cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | beta-galactosidase activity Ref.1 Traceable author statement. Source: UniProtKB cation bindingInferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CTNNBIP1 | Q9NSA3 | 1 | EBI-989638,EBI-747082 | |
| NEU1 | Q99519 | 1 | EBI-989638,EBI-721517 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P16278-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P16278-2) Also known as: Beta-galactosidase-related protein; Beta-galactosidase-like protein; S-Gal; Elastin-binding protein; EBP; The sequence of this isoform differs from the canonical sequence as follows: 83-244: YVPWNFHEPW...GLYTTVDFGT → LPGSCGQVVGSPSAQDEASPLSEWRASYNSA | ||||||
| Note: Localized to the perinuclear area of the cytoplasm but not to lysosomes. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | |||||||
| Propeptide | 24 – 28 | 5 | PRO_0000012185 | ||||||
| Chain | 29 – 677 | 649 | Beta-galactosidase | PRO_0000012186 | |||||
Sites | |||||||||
| Active site | 188 | 1 | Proton donor Potential | ||||||
| Active site | 268 | 1 | Nucleophile Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 26 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 247 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 464 | 1 | N-linked (GlcNAc...) Ref.13 Ref.15 | ||||||
| Glycosylation | 498 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 542 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 545 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 555 | 1 | N-linked (GlcNAc...) Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 83 – 244 | 162 | YVPWN…VDFGT → LPGSCGQVVGSPSAQDEASP LSEWRASYNSA in isoform 2. | VSP_031241 | |||||
| Natural variant | 10 | 1 | P → L in GM1G1. dbSNP rs7637099. | VAR_008671 | |||||
| Natural variant | 49 | 1 | R → C in GM1G1. Ref.17 | VAR_003329 | |||||
| Natural variant | 49 | 1 | R → H in GM1G3. | VAR_062340 | |||||
| Natural variant | 51 | 1 | I → T in GM1G3. Ref.17 Ref.18 | VAR_003330 | |||||
| Natural variant | 59 | 1 | R → C in GM1G1; protein enzymatically inactive; severe mutation. Ref.25 Ref.30 Ref.35 Ref.40 | VAR_026129 | |||||
| Natural variant | 59 | 1 | R → H in GM1G1; with cardiac involvement in some patients; protein enzymatically inactive; severe mutation. Ref.25 Ref.28 Ref.30 Ref.35 Ref.40 | VAR_008672 | |||||
| Natural variant | 68 | 1 | R → Q in GM1G2; 7.4% of wild-type enzyme activity. | VAR_062341 | |||||
| Natural variant | 68 | 1 | R → W in GM1G2; no enzyme activity. Ref.32 | VAR_026130 | |||||
| Natural variant | 73 | 1 | K → E in GM1G3. | VAR_062342 | |||||
| Natural variant | 82 | 1 | T → M in GM1G3; mild phenotype. Ref.21 Ref.31 | VAR_008673 | |||||
| Natural variant | 83 | 1 | Y → C in MPS4B. | VAR_062343 | |||||
| Natural variant | 83 | 1 | Y → H in MPS4B; 2-5% of activity. Ref.23 | VAR_008674 | |||||
| Natural variant | 109 | 1 | R → W: dbSNP rs35289681. | VAR_053875 | |||||
| Natural variant | 121 | 1 | R → S in GM1G1. Ref.28 | VAR_008675 | |||||
| Natural variant | 123 | 1 | G → R in GM1G1. | VAR_003331 | |||||
| Natural variant | 132 | 1 | M → T in GM1G1; 4.3% of wild-type enzyme activity. | VAR_062344 | |||||
| Natural variant | 134 | 1 | G → V in GM1G1. Ref.40 | VAR_037937 | |||||
| Natural variant | 136 | 1 | P → S in GM1G1. | VAR_062345 | |||||
| Natural variant | 147 | 1 | Missing in GM1G1. | VAR_037938 | |||||
| Natural variant | 148 | 1 | R → C in GM1G3. | VAR_062346 | |||||
| Natural variant | 148 | 1 | R → S in GM1G1. Ref.22 Ref.29 | VAR_013541 | |||||
| Natural variant | 149 | 1 | S → F in MPS4B; 2.0% of wild-type enzyme activity. | VAR_062347 | |||||
| Natural variant | 151 | 1 | D → V in GM1G1. | VAR_062348 | |||||
| Natural variant | 151 | 1 | D → Y in GM1G1; complete lack of protein; no enzymatic activity. Ref.33 | VAR_026131 | |||||
| Natural variant | 155 | 1 | L → R in GM1G2 and GM1G3; 6.7% of wild-type enzyme activity. | VAR_037939 | |||||
| Natural variant | 162 | 1 | L → S in GM1G1. Ref.40 | VAR_037940 | |||||
| Natural variant | 173 | 1 | L → P in GM1G1. | VAR_062349 | |||||
| Natural variant | 184 | 1 | Q → R in GM1G1; no enzymatic activity. | VAR_062350 | |||||
| Natural variant | 190 | 1 | G → D in GM1G1; 3.4% of wild-type enzyme activity. | VAR_062351 | |||||
| Natural variant | 198 | 1 | D → Y in MPS4B; 17.4% of wild-type enzyme activity. | VAR_062352 | |||||
| Natural variant | 199 | 1 | Y → C in GM1G1. | VAR_062353 | |||||
| Natural variant | 201 | 1 | R → C in GM1G1 and GM1G2; 8.4% of wild-type enzyme activity; activity severely reduced in transfection with the F-436 polymorphism. | VAR_003332 | |||||
| Natural variant | 201 | 1 | R → H in GM1G2; 36.2% of wild-type enzyme activity; also in GM1G1 and a patient with a slowly progressive GM1-gangliosidosis form. | VAR_013542 | |||||
| Natural variant | 208 | 1 | R → C in GM1G1. Ref.20 Ref.28 Ref.35 Ref.40 | VAR_008676 | |||||
| Natural variant | 214 | 1 | D → Y in GM1G3. Ref.22 | VAR_013543 | |||||
| Natural variant | 216 | 1 | V → A in GM1G1. Ref.22 | VAR_013544 | |||||
| Natural variant | 239 | 1 | T → M in GM1G1; protein enzymatically inactive; severe mutation; causes a rapid degradation of the protein precursor. Ref.35 | VAR_026132 | |||||
| Natural variant | 240 | 1 | V → M in GM1G1. Ref.28 | VAR_008677 | |||||
| Natural variant | 255 | 1 | Q → H in GM1G1; 2.4% of wild-type enzyme activity. | VAR_062354 | |||||
| Natural variant | 263 | 1 | P → S in GM1G3. Ref.24 | VAR_013545 | |||||
| Natural variant | 264 | 1 | L → S in GM1G2. | VAR_062355 | |||||
| Natural variant | 266 | 1 | N → S in GM1G3. Ref.26 | VAR_013546 | |||||
| Natural variant | 270 | 1 | Y → D in GM1G3; originally classified as Morquio syndrome. Ref.31 | VAR_013547 | |||||
| Natural variant | 272 | 1 | G → D in GM1G1. Ref.40 | VAR_038346 | |||||
| Natural variant | 273 | 1 | W → L in MPS4B; 8% of activity. Ref.16 Ref.31 | VAR_003333 | |||||
| Natural variant | 281 | 1 | H → Y in GM1G1 and GM1G3. Ref.35 Ref.31 | VAR_013548 | |||||
| Natural variant | 316 | 1 | Y → C in GM1G1. Ref.18 | VAR_003334 | |||||
| Natural variant | 318 | 1 | N → H in GM1G1; uncertain pathogenicity. | VAR_062356 | |||||
| Natural variant | 329 | 1 | T → I in GM1G1; 5.0% of wild-type enzyme activity. | VAR_062357 | |||||
| Natural variant | 332 | 1 | D → E in GM1G1; 2.3% of wild-type enzyme activity. | VAR_062358 | |||||
| Natural variant | 332 | 1 | D → N in GM1G1. Ref.29 | VAR_013549 | |||||
| Natural variant | 333 | 1 | Y → H in GM1G2; 3.0% of wild-type enzyme activity; the mutant protein is localized in the lysosomal-endosomal compartment. | VAR_062359 | |||||
| Natural variant | 346 | 1 | K → N in GM1G1. | VAR_062360 | |||||
| Natural variant | 347 | 1 | Y → C in GM1G1. | VAR_062361 | |||||
| Natural variant | 377 – 381 | 5 | Missing in GM1G1. | VAR_037941 | |||||
| Natural variant | 397 | 1 | P → A in MPS4B; 24.0% of wild-type enzyme activity. | VAR_062362 | |||||
| Natural variant | 408 | 1 | Q → P in MPS4B; 1.1% of wild-type enzyme activity. | VAR_013550 | |||||
| Natural variant | 420 | 1 | T → K in GM1G3. | VAR_062363 | |||||
| Natural variant | 420 | 1 | T → P in GM1G1. | VAR_062364 | |||||
| Natural variant | 422 | 1 | L → R in GM1G1. | VAR_062365 | |||||
| Natural variant | 434 | 1 | S → L in GM1-gangliosidosis; unclassified clinical type. Ref.40 | VAR_037942 | |||||
| Natural variant | 436 | 1 | L → F Seems to have a modulating action in the expression of the severity of other mutations. dbSNP rs34421970. | VAR_026133 | |||||
| Natural variant | 438 | 1 | G → E in GM1G3 and MPS4B; mild form; 5.7% of activity. | VAR_013551 | |||||
| Natural variant | 441 | 1 | D → N in GM1G1. | VAR_062366 | |||||
| Natural variant | 442 | 1 | R → Q in GM1G1. | VAR_062367 | |||||
| Natural variant | 444 | 1 | Y → C in MPS4B. | VAR_062368 | |||||
| Natural variant | 457 | 1 | R → Q in GM1G3. | VAR_003335 | |||||
| Natural variant | 482 | 1 | R → C in MPS4B; loss of activity. Ref.23 | VAR_008678 | |||||
| Natural variant | 482 | 1 | R → H in MPS4B and GM1G1; loss of activity. Ref.16 Ref.19 Ref.30 Ref.35 | VAR_003336 | |||||
| Natural variant | 484 | 1 | N → K in MPS4B; mild form; 1.9% of activity. Ref.27 | VAR_013552 | |||||
| Natural variant | 491 | 1 | D → N in GM1G1. Ref.28 | VAR_008679 | |||||
| Natural variant | 491 | 1 | D → Y in GM1G1. Ref.40 | VAR_037943 | |||||
| Natural variant | 494 | 1 | G → C in GM1G1. Ref.16 | VAR_013553 | |||||
| Natural variant | 494 | 1 | G → S in MPS4B. | VAR_062369 | |||||
| Natural variant | 500 | 1 | T → A in MPS4B; mild form; 2.1% of activity. Ref.31 Ref.27 | VAR_013554 | |||||
| Natural variant | 509 | 1 | W → C in MPS4B; also in a patient with a slowly progressive form of GM1-gangisidosis; loss of activity. Ref.16 Ref.26 | VAR_003337 | |||||
| Natural variant | 521 | 1 | R → C in a GM1-gangliosidosis patient; mild phenotype; reduction of activity; could be a polymorphism. dbSNP rs4302331. Ref.28 Ref.35 Ref.6 | VAR_008680 | |||||
| Natural variant | 532 | 1 | S → G | VAR_008681 | |||||
| Natural variant | 549 | 1 | P → L in GM1G1. Ref.40 | VAR_037944 | |||||
| Natural variant | 554 | 1 | G → E in GM1-gangliosidosis; unclassified clinical type. Ref.40 | VAR_037945 | |||||
| Natural variant | 578 | 1 | K → R in GM1G1. Ref.20 | VAR_008682 | |||||
| Natural variant | 579 | 1 | G → D in GM1G1 and GM1G2; protein enzymatically inactive; severe mutation. Ref.30 Ref.35 | VAR_013555 | |||||
| Natural variant | 590 | 1 | R → C in GM1G1. Ref.40 | VAR_037946 | |||||
| Natural variant | 590 | 1 | R → H in GM1G2. Ref.20 | VAR_008683 | |||||
| Natural variant | 591 | 1 | Y → C in GM1G1; with cardiac involvement in some patients; protein enzymatically inactive; severe mutation; causes a rapid degradation of the protein precursor. Ref.25 Ref.30 Ref.35 | VAR_008684 | |||||
| Natural variant | 591 | 1 | Y → N in GM1G1; with cardiac involvement in some patients; protein enzymatically inactive; severe mutation; causes a rapid degradation of the protein precursor. Ref.25 Ref.30 Ref.35 | VAR_008685 | |||||
| Natural variant | 595 | 1 | R → W Reduction of activity. Ref.41 | VAR_037947 | |||||
| Natural variant | 597 | 1 | P → S in GM1G1; 2.1% of wild-type enzyme activity. | VAR_062370 | |||||
| Natural variant | 632 | 1 | E → G in GM1G2. Ref.20 | VAR_008686 | |||||
Experimental info | |||||||||
| Sequence conflict | 201 | 1 | R → A in AAA51822. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, sequencing, and expression of cDNA for human beta-galactosidase." Oshima A., Tsuji A., Nagao Y., Sakuraba H., Suzuki Y. Biochem. Biophys. Res. Commun. 157:238-244(1988) [PubMed: 3143362] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Alternative splicing of beta-galactosidase mRNA generates the classic lysosomal enzyme and a beta-galactosidase-related protein." Morreau H., Galjart N.J., Gillemans N., Willemsen R., van der Horst G.T.J., D'Azzo A. J. Biol. Chem. 264:20655-20663(1989) [PubMed: 2511208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), PARTIAL PROTEIN SEQUENCE, VARIANT LEU-10. Tissue: Testis. |
| [3] | "Isolation, characterization, and mapping of a human acid beta-galactosidase cDNA." Yamamoto Y., Hake C.A., Martin B.M., Kretz K.A., Ahern-Rindell A.J., Naylor S.L., Mudd M., O'Brien J.S. DNA Cell Biol. 9:119-127(1990) [PubMed: 2111707] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-10. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-10. |
| [6] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT CYS-521. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-10. Tissue: Colon. |
| [8] | "The 67-kD elastin/laminin-binding protein is related to an enzymatically inactive, alternatively spliced form of beta-galactosidase." Hinek A., Rabinovitch M., Keeley F., Okamura-Oho Y., Callahan J. J. Clin. Invest. 91:1198-1205(1993) [PubMed: 8383699] [Abstract] Cited for: DOMAIN ELASTIN/LAMININ BINDING. |
| [9] | "Biological roles of the non-integrin elastin/laminin receptor." Hinek A. Biol. Chem. 377:471-480(1996) [PubMed: 8922281] [Abstract] Cited for: FUNCTION (ISOFORM 2). |
| [10] | "The 67-kDa enzymatically inactive alternatively spliced variant of beta-galactosidase is identical to the elastin/laminin-binding protein." Privitera S., Prody C.A., Callahan J.W., Hinek A. J. Biol. Chem. 273:6319-6326(1998) [PubMed: 9497360] [Abstract] Cited for: IDENTITY OF BETA-GALACTOSIDASE-RELATED PROTEIN WITH EBP. |
| [11] | "Molecular basis of GM1 gangliosidosis and Morquio disease, type B. Structure-function studies of lysosomal beta-galactosidase and the non-lysosomal beta-galactosidase-like protein." Callahan J.W. Biochim. Biophys. Acta 1455:85-103(1999) [PubMed: 10571006] [Abstract] Cited for: REVIEW. |
| [12] | "Impaired elastic-fiber assembly by fibroblasts from patients with either Morquio B disease or infantile GM1-gangliosidosis is linked to deficiency in the 67-kD spliced variant of beta-galactosidase." Hinek A., Zhang S., Smith A.C., Callahan J.W. Am. J. Hum. Genet. 67:23-36(2000) [PubMed: 10841810] [Abstract] Cited for: ELASTIC-FIBER ASSEMBLY STUDIES. |
| [13] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed: 16263699] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-464, MASS SPECTROMETRY. Tissue: Platelet. |
| [14] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [15] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-464 AND ASN-555, MASS SPECTROMETRY. Tissue: Liver. |
| [16] | "Human beta-galactosidase gene mutations in morquio B disease." Oshima A., Yoshida K., Shimmoto M., Fukuhara Y., Sakuraba H., Suzuki Y. Am. J. Hum. Genet. 49:1091-1093(1991) [PubMed: 1928092] [Abstract] Cited for: VARIANTS MPS4B LEU-273; HIS-482 AND CYS-509, VARIANT GM1G1 CYS-494. |
| [17] | "GM1-gangliosidosis (genetic beta-galactosidase deficiency): identification of four mutations in different clinical phenotypes among Japanese patients." Nishimoto J., Nanba E., Inui K., Okada S., Suzuki K. Am. J. Hum. Genet. 49:566-574(1991) [PubMed: 1909089] [Abstract] Cited for: VARIANT GM1G1 CYS-49, VARIANT GM1G3 THR-51, VARIANT GM1G2 CYS-201. |
| [18] | "Human beta-galactosidase gene mutations in GM1-gangliosidosis: a common mutation among Japanese adult/chronic cases." Yoshida K., Oshima A., Shimmoto M., Fukuhara Y., Sakuraba H., Yanagisawa N., Suzuki Y. Am. J. Hum. Genet. 49:435-442(1991) [PubMed: 1907800] [Abstract] Cited for: VARIANTS GM1G3 THR-51 AND GLN-457, VARIANTS GM1G1 ARG-123 AND CYS-316, VARIANT GM1G2 CYS-201. |
| [19] | "A homozygous missense arginine to histidine substitution at position 482 of the beta-galactosidase in an Italian infantile GM1-gangliosidosis patient." Mosna G., Fattore S., Tubiello G., Brocca S., Trubia M., Gianazza E., Gatti R., Danesino C., Minelli A., Piantanida M. Hum. Genet. 90:247-250(1992) [PubMed: 1487238] [Abstract] Cited for: VARIANT GM1G1 HIS-482. |
| [20] | "Mutations in acid beta-galactosidase cause GM1-gangliosidosis in American patients." Boustany R.-M.N., Qian W.-H., Suzuki K. Am. J. Hum. Genet. 53:881-888(1993) [PubMed: 8213816] [Abstract] Cited for: VARIANTS GM1G1 CYS-208 AND ARG-578, VARIANTS GM1G2 HIS-590 AND GLY-632. |
| [21] | "Mutations in the lysosomal beta-galactosidase gene that cause the adult form of GM1 gangliosidosis." Chakraborty S., Rafi M.A., Wenger D.A. Am. J. Hum. Genet. 54:1004-1013(1994) [PubMed: 8198123] [Abstract] Cited for: VARIANT GM1G3 MET-82. |
| [22] | "Novel missense mutations in beta-glactosidase that result in GM1-gangliosidosis." Hilson W.L., Okamura-Oho Y., Zhang S., Clarke J.T.R., Mahuran D., Callahan J.W. Am. J. Hum. Genet. 55:A223-A223(1994) Cited for: VARIANTS GM1G1 SER-148 AND ALA-216, VARIANT GM1G3 TYR-214, VARIANT GLY-532. |
| [23] | "Clinical and molecular analysis of a Japanese boy with Morquio B disease." Ishii N., Oohira T., Oshima A., Sakuraba H., Endo F., Matsuda I., Sukegawa K., Orii T., Suzuki Y. Clin. Genet. 48:103-108(1995) [PubMed: 7586649] [Abstract] Cited for: VARIANTS MPS4B HIS-83 AND CYS-482. |
| [24] | "Beta-galactosidase deficiency (beta-galactosidosis): GM1 gangliosidosis and Morquio B disease." Suzuki Y., Sakuraba H., Oshima A. (In) Scriver C.R., Beaudet A.L., Sly W.S., Valle D. (eds.); The metabolic and molecular bases of inherited disease, pp.2787-2823, McGraw-Hill Publishing Co., New York (1995) Cited for: VARIANT GM1G3 SER-263. |
| [25] | "Identification of new mutations in six Italian patients affected by a variant form of infantile GM1-gangliosidosis with severe cardiomyopathy." Morrone A., Bardelli T., Donati M.A., Giorgi M., Di Rocco R., Gatti R., Taddeucci G., Ricci R., D'Azzo A., Zammarchi E. Am. J. Hum. Genet. 61:A258-A258(1997) Cited for: VARIANTS GM1G1 HIS-59; ASN-591 AND CYS-591. |
| [26] | "Beta-Galactosidase gene mutations in patients with slowly progressive GM1 gangliosidosis." Kaye E.M., Shalish C., Livermore J., Taylor H.A., Stevenson R.E., Breakefield X.O. J. Child Neurol. 12:242-247(1997) [PubMed: 9203065] [Abstract] Cited for: VARIANTS SLOWLY PROGRESSIVE GM1-GANGLIOSIDOSIS HIS-201; SER-266 AND CYS-509. |
| [27] | "Novel mutations (Asn 484 Lys, Thr 500 Ala, Gly 438 Glu) in Morquio B disease." Bagshaw R.D., Zhang S., Hinek A., Skomorowski M.-A., Whelan D., Clarke J.T.R., Callahan J.W. Biochim. Biophys. Acta 1588:247-253(2002) [PubMed: 12393180] [Abstract] Cited for: VARIANTS MPS4B GLU-438; LYS-484 AND ALA-500. |
| [28] | "Six novel beta-galactosidase gene mutations in Brazilian patients with GM1-gangliosidosis." Silva C.M.D., Severini M.H., Sopelsa A., Coelho J.C., Zaha A., d'Azzo A., Giugliani R. Hum. Mutat. 13:401-409(1999) [PubMed: 10338095] [Abstract] Cited for: VARIANTS GM1G1 HIS-59; SER-121; CYS-208; MET-240 AND ASN-491, VARIANTS LEU-10; CYS-521 AND GLY-532. |
| [29] | "Characterization of beta-galactosidase mutations Asp332-->Asn and Arg148-->Ser, and a polymorphism, Ser532-->Gly, in a case of GM1 gangliosidosis." Zhang S., Bagshaw R., Hilson W., Oho Y., Hinek A., Clarke J.T.R., Hinek A., Callahan J.W. Biochem. J. 348:621-632(2000) [PubMed: 10839995] [Abstract] Cited for: VARIANTS GM1G1 SER-148 AND ASN-332, VARIANT GLY-532. |
| [30] | "Beta-galactosidase gene mutations affecting the lysosomal enzyme and the elastin-binding protein in GM1-gangliosidosis patients with cardiac involvement." Morrone A., Bardelli T., Donati M.A., Giorgi M., Di Rocco M., Gatti R., Parini R., Ricci R., Taddeucci G., D'Azzo A., Zammarchi E. Hum. Mutat. 15:354-366(2000) [PubMed: 10737981] [Abstract] Cited for: VARIANTS GM1G1 HIS-59; HIS-482; ASN-591 AND CYS-591, VARIANTS GM1G2 HIS-201 AND ASP-579. |
| [31] | "Mutation analyses in 17 patients with deficiency in acid beta-galactosidase: three novel point mutations and high correlation of mutation W273L with Morquio disease type B." Paschke E., Milos I., Kreimer-Erlacher H., Hoefler G., Beck M., Hoeltzenbein M., Kleijer W., Levade T., Michelakakis H., Radeva B. Hum. Genet. 109:159-166(2001) [PubMed: 11511921] [Abstract] Cited for: VARIANTS MPS4B LEU-273; PRO-408 AND ALA-500, VARIANTS GM1G3 MET-82; ASP-270 AND TYR-281, VARIANT LEU-10. |
| [32] | "Modulating action of the new polymorphism L436F detected in the GLB1 gene of a type-II GM1 gangliosidosis patient." Caciotti A., Bardelli T., Cunningham J., D'Azzo A., Zammarchi E., Morrone A. Hum. Genet. 113:44-50(2003) [PubMed: 12644936] [Abstract] Cited for: VARIANTS GM1G2 TRP-68 AND CYS-201, CHARACTERIZATION OF VARIANTS GM1G2 TRP-68 AND CYS-201, VARIANT PHE-436, MODULATING ACTION OF VARIANT PHE-436. |
| [33] | "Four novel mutations in patients from the Middle East with the infantile form of GM1-gangliosidosis." Georgiou T., Drousiotou A., Campos Y., Caciotti A., Sztriha L., Gururaj A., Ozand P., Zammarchi E., Morrone A., D'Azzo A. Hum. Mutat. 24:352-352(2004) [PubMed: 15365997] [Abstract] Cited for: VARIANT GM1G1 TYR-151, CHARACTERIZATION OF VARIANT GM1G1 TYR-151. |
| [34] | Erratum Georgiou T., Drousiotou A., Campos Y., Caciotti A., Sztriha L., Gururaj A., Ozand P., Zammarchi E., Morrone A., D'Azzo A. Hum. Mutat. 24:536-537(2004) |
| [35] | "Role of beta-galactosidase and elastin binding protein in lysosomal and nonlysosomal complexes of patients with GM1-gangliosidosis." Caciotti A., Donati M.A., Boneh A., d'Azzo A., Federico A., Parini R., Antuzzi D., Bardelli T., Nosi D., Kimonis V., Zammarchi E., Morrone A. Hum. Mutat. 25:285-292(2005) [PubMed: 15714521] [Abstract] Cited for: VARIANTS GM1G1 HIS-59; CYS-59; CYS-208; MET-239; TYR-281; HIS-482; ASP-579; ASN-591 AND CYS-591, VARIANT GM1G2 HIS-201, VARIANT CYS-521, CHARACTERIZATION OF VARIANTS GM1G1 HIS-59; CYS-59; CYS-208; MET-239; TYR-281; HIS-482; ASP-579; ASN-591 AND CYS-591, CHARACTERIZATION OF VARIANT GM1G2 HIS-201, CHARACTERIZATION OF VARIANT CYS-521. |
| [36] | "Magnetic resonance imaging findings and novel mutations in GM1 gangliosidosis." Gururaj A., Sztriha L., Hertecant J., Johansen J.G., Georgiou T., Campos Y., Drousiotou A., d'Azzo A. J. Child Neurol. 20:57-60(2005) [PubMed: 15791924] [Abstract] Cited for: VARIANTS GM1G1 LEU-10 AND TYR-151. |
| [37] | "Dystonia and parkinsonism in GM1 type 3 gangliosidosis." Roze E., Paschke E., Lopez N., Eck T., Yoshida K., Maurel-Ollivier A., Doummar D., Caillaud C., Galanaud D., Billette de Villemeur T., Vidailhet M., Roubergue A. Mov. Disord. 20:1366-1369(2005) [PubMed: 15986423] [Abstract] Cited for: VARIANTS GM1G3 HIS-49; GLU-73; CYS-148 AND GLU-438. |
| [38] | "Twenty-one novel mutations in the GLB1 gene identified in a large group of GM1-gangliosidosis and Morquio B patients: possible common origin for the prevalent p.R59H mutation among Gypsies." Santamaria R., Chabas A., Coll M.J., Miranda C.S., Vilageliu L., Grinberg D. Hum. Mutat. 27:1060-1060(2006) [PubMed: 16941474] [Abstract] Cited for: VARIANTS GM1G1 CYS-59; HIS-59; SER-136; VAL-151; PRO-173; CYS-199; ASP-272; ASN-346; CYS-347; PRO-420; ARG-422; ASN-441 AND CYS-590, VARIANT GM1G2 SER-264, VARIANTS GM1G3 HIS-201 AND LYS-420, VARIANTS MPS4B CYS-83; CYS-444; SER-494 AND ALA-500, VARIANTS PHE-436; CYS-521 AND GLY-532. |
| [39] | "Elastogenesis in cultured dermal fibroblasts from patients with lysosomal beta-galactosidase, protective protein/cathepsin A and neuraminidase-1 deficiencies." Tatano Y., Takeuchi N., Kuwahara J., Sakuraba H., Takahashi T., Takada G., Itoh K. J. Med. Invest. 53:103-112(2006) [PubMed: 16538002] [Abstract] Cited for: VARIANTS MPS4B LEU-273; HIS-482 AND CYS-509, VARIANTS GM1G1 CYS-201; HIS-201 AND HIS-318. |
| [40] | "Identification of 14 novel GLB1 mutations, including five deletions, in 19 patients with GM1 gangliosidosis from South America." Santamaria R., Blanco M., Chabas A., Grinberg D., Vilageliu L. Clin. Genet. 71:273-279(2007) [PubMed: 17309651] [Abstract] Cited for: VARIANTS GM1G1 CYS-59; HIS-59; VAL-134; LEU-147 DEL; SER-162; CYS-208; ASP-272; 377-VAL--LYS-381 DEL; TYR-491; LEU-549 AND CYS-590, VARIANT GM1G2 HIS-201, VARIANT GM1G3 ARG-155, VARIANTS GM1-GANGLIOSIDOSIS LEU-434 AND GLU-554. |
| [41] | "Identification of a novel pseudodeficiency allele in the GLB1 gene in a carrier of GM1 gangliosidosis." Gort L., Santamaria R., Grinberg D., Vilageliu L., Chabas A. Clin. Genet. 72:109-111(2007) [PubMed: 17661814] [Abstract] Cited for: VARIANT TRP-595, CHARACTERIZATION OF VARIANT TRP-595. |
| [42] | "GM1 gangliosidosis and Morquio B disease: expression analysis of missense mutations affecting the catalytic site of acid beta-galactosidase." Hofer D., Paul K., Fantur K., Beck M., Buerger F., Caillaud C., Fumic K., Ledvinova J., Lugowska A., Michelakakis H., Radeva B., Ramaswami U., Plecko B., Paschke E. Hum. Mutat. 30:1214-1221(2009) [PubMed: 19472408] [Abstract] Cited for: VARIANTS GM1G1 HIS-59; THR-132; ARG-184; ASP-190; CYS-201; HIS-201; MET-239; HIS-255; ILE-329; GLU-332; ASN-346; GLN-442 AND SER-597, VARIANTS GM1G2 GLN-68; ARG-155 AND HIS-333, VARIANTS GM1G3 MET-82; ASP-270 AND GLU-438, VARIANTS MPS4B PHE-149; TYR-198; LEU-273; ALA-397; PRO-408 AND ALA-500, CHARACTERIZATION OF VARIANTS GM1G1 THR-132; ARG-184; ASP-190; CYS-201; HIS-201; HIS-255; ILE-329; GLU-332 AND SER-597, CHARACTERIZATION OF VARIANTS GM1G2 GLN-68; ARG-155 AND HIS-333, CHARACTERIZATION OF VARIANTS GM1G3 ASP-270 AND GLU-438, CHARACTERIZATION OF VARIANTS MPS4B PHE-149; TYR-198; LEU-273; ALA-397; PRO-408 AND ALA-500. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M22590 mRNA. Translation: AAA51822.1. M27507 mRNA. Translation: AAA51819.1. M27508 mRNA. Translation: AAA35599.1. M34423 mRNA. Translation: AAA51823.1. AK312988 mRNA. Translation: BAG35825.1. BT007147 mRNA. Translation: AAP35811.1. AC112211 Genomic DNA. No translation available. BC007493 mRNA. Translation: AAH07493.1. |
| IPI | IPI00441344. IPI00441550. |
| PIR | A32611. A32688. B32688. |
| RefSeq | NP_000395.2. NP_001073279.1. NP_001129074.1. |
| UniGene | Hs.443031 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P16278. 3 interactions. |
| STRING | P16278. |
Protein family/group databases | |
| CAZy | GH35. Glycoside Hydrolase Family 35. |
PTM databases | |
| PhosphoSite | P16278. |
Proteomic databases | |
| PRIDE | P16278. |
Genome annotation databases | |
| Ensembl | ENST00000307363; ENSP00000306920; ENSG00000170266; Homo sapiens. [Genome view] |
| GeneID | 2720. |
| KEGG | hsa:2720. |
| UCSC | uc003cfj.1. human. |
Organism-specific databases | |
| CTD | 2720. |
| GeneCards | GC03M033013. |
| H-InvDB | HIX0003151. |
| HGNC | HGNC:4298. GLB1. |
| HPA | CAB008382. |
| MIM | 230500. phenotype. 230600. phenotype. 230650. phenotype. 253010. phenotype. 611458. gene. |
| Orphanet | 79255. Gangliosidosis GM1, type 1. 79257. Gangliosidosis GM1, type 3. 354. GM1 gangliosidosis. 582. Mucopolysaccharidosis type 4. |
| PharmGKB | PA28709. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13199. |
| HOVERGEN | P16278. |
| InParanoid | P16278. |
Enzyme and pathway databases | |
| BRENDA | 3.2.1.23. 247. |
Gene expression databases | |
| ArrayExpress | P16278. |
| Bgee | P16278. |
| CleanEx | HS_GLB1. |
| Genevestigator | P16278. |
| GermOnline | ENSG00000170266. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019801. Glyco_hydro_35_CS. IPR017853. Glyco_hydro_catalytic_core. IPR013781. Glyco_hydro_sg_catalytic. IPR001944. Glycoside_Hdrlase_35. [Graphical view] |
| Gene3D | G3DSA:3.20.20.80. Glyco_hydro_cat. 1 hit. |
| PANTHER | PTHR23421. Glyco_hydro_35. 1 hit. |
| Pfam | PF01301. Glyco_hydro_35. 1 hit. [Graphical view] |
| PRINTS | PR00742. GLHYDRLASE35. |
| PROSITE | PS01182. GLYCOSYL_HYDROL_F35. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 10738. |
| SOURCE | Search... |
Entry information
| Entry name | BGAL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P16278 Secondary accession number(s): B2R7H8, P16279 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


