P16157 (ANK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ankyrin-1 Short name=ANK-1 Alternative name(s): Ankyrin-R Erythrocyte ankyrin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1881 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Attaches integral membrane proteins to cytoskeletal elements; binds to the erythrocyte membrane protein band 4.2, to Na-K ATPase, to the lymphocyte membrane protein GP85, and to the cytoskeletal proteins fodrin, tubulin, vimentin and desmin. Erythrocyte ankyrins also link spectrin (beta chain) to the cytoplasmic domain of the erythrocytes anion exchange protein; they retain most or all of these binding functions. Ref.14 Isoform Mu17 together with obscurin in skeletal muscle may provide a molecular link between the sarcoplasmic reticulum and myofibrils. Ref.14 |
| Subunit structure | Interacts with a number of integral membrane proteins and cytoskeletal proteins. Binds SPTB/spectrin (beta chain) through a 70 AA N-terminal region of the 62 kDa domain, and the C-terminal of SLC4A1/erythrocyte membrane protein band 3 through the ankyrin repeat region. Also interacts with TTN/titin. Isoform Mu17 interacts with OBSCN isoform 3/obscurin. Ref.9 Ref.10 |
| Subcellular location | Isoform Er1: Cytoplasm › cytoskeleton. Note: Probably the other erythrocyte (Er) isoforms, are located near the surface of erythrocytic plasma membrane. Ref.4 Ref.10 Isoform Mu17: Membrane. Cytoplasm › myofibril › sarcomere › M line. Note: Colocalizes with OBSCN isoform 3/obscurin at the M line in differentiated skeletal muscle cells. Ref.4 Ref.10 Isoform Mu18: Sarcoplasmic reticulum Probable Ref.4 Ref.10. Isoform Mu19: Sarcoplasmic reticulum Probable Ref.4 Ref.10. Isoform Mu20: Sarcoplasmic reticulum Probable Ref.4 Ref.10. |
| Tissue specificity | Isoform Mu17, isoform Mu18, isoform Mu19 and isoform Mu20 are expressed in skeletal muscle. Isoform Br21 is expressed in brain. Ref.4 |
| Domain | The 55 kDa regulatory domain is involved in regulating binding of SPTB/spectrin (beta chain) and SLC4A1/erythrocyte membrane protein band 3. Ref.8 Ref.14 The ANK repeat region forms a spiral around a large central cavity and is involved in binding of ion transporters. Ref.8 Ref.14 |
| Post-translational modification | Regulated by phosphorylation. Palmitoylated. |
| Involvement in disease | Defects in ANK1 are a cause of spherocytosis type 1 (SPH1) [MIM:182900]; also called hereditary spherocytosis type 1 (HS1). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Inheritance can be autosomal dominant or recessive. Ref.16 Ref.17 |
| Sequence similarities | Contains 23 ANK repeats. Contains 1 death domain. Contains 1 ZU5 domain. |
| Sequence caution | The sequence AAB47805.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| OBSCN | Q5VST9-3 | 3 | EBI-941686,EBI-941921 |
Alternative products
| This entry describes 21 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform Er1 (identifier: P16157-1) Also known as: 1; 2.1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major erythrocyte-specific isoform. Produced by alternative promoter usage. | ||||||
| Isoform Er2 (identifier: P16157-4) Also known as: 2; 2.2; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. | ||||||
| Note: Predominant form of minor erythrocyte-specific isoforms. Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er3 (identifier: P16157-5) Also known as: 3; The sequence of this isoform differs from the canonical sequence as follows: 1849-1873: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er4 (identifier: P16157-6) Also known as: 4; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. 1849-1873: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er5 (identifier: P16157-3) Also known as: 5; The sequence of this isoform differs from the canonical sequence as follows: 1850-1881: TVEGPLEDPSELEVDIDYFMKHSKDHTSTPNP → ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er6 (identifier: P16157-7) Also known as: 6; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. 1850-1881: TVEGPLEDPSELEVDIDYFMKHSKDHTSTPNP → ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er7 (identifier: P16157-8) Also known as: 7; The sequence of this isoform differs from the canonical sequence as follows: 1827-1873: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er8 (identifier: P16157-9) Also known as: 8; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. 1827-1873: Missing. | ||||||
| Isoform Er9 (identifier: P16157-10) Also known as: 9; The sequence of this isoform differs from the canonical sequence as follows: 1799-1873: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er10 (identifier: P16157-11) Also known as: 10; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. 1799-1873: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er11 (identifier: P16157-12) Also known as: 11; The sequence of this isoform differs from the canonical sequence as follows: 1874-1881: DHTSTPNP → VELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er12 (identifier: P16157-13) Also known as: 12; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. 1874-1881: DHTSTPNP → VELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er13 (identifier: P16157-14) Also known as: 13; The sequence of this isoform differs from the canonical sequence as follows: 1874-1881: DHTSTPNP → VLRRPRPWGT...KRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er14 (identifier: P16157-15) Also known as: 14; The sequence of this isoform differs from the canonical sequence as follows: 1514-1675: Missing. 1874-1881: DHTSTPNP → VLRRPRPWGT...KRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er15 (identifier: P16157-16) Also known as: 15; The sequence of this isoform differs from the canonical sequence as follows: 1827-1881: IIRKVVRQID...SKDHTSTPNP → VELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Er16 (identifier: P16157-2) The sequence of this isoform differs from the canonical sequence as follows: 1513-1874: Missing. 1875-1875: H → D | ||||||
| Note: Produced by alternative splicing of isoform Er1. | ||||||
| Isoform Mu17 (identifier: P16157-17) Also known as: ank1.5; muscle-specific 1; The sequence of this isoform differs from the canonical sequence as follows: 1-1725: Missing. 1726-1798: TQGPHSFQGT...AKNTFTQVVQ → MWTFVTQLLV...RVVRRRVFLK 1850-1881: TVEGPLEDPSELEVDIDYFMKHSKDHTSTPNP → ELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform Mu18 (identifier: P16157-18) Also known as: ank1.6; muscle-specific 2; The sequence of this isoform differs from the canonical sequence as follows: 1-1725: Missing. 1726-1798: TQGPHSFQGT...AKNTFTQVVQ → MWTFVTQLLV...RVVRRRVFLK 1827-1881: IIRKVVRQID...SKDHTSTPNP → VELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Mu17. | ||||||
| Isoform Mu19 (identifier: P16157-19) Also known as: muscle-specific 3; The sequence of this isoform differs from the canonical sequence as follows: 1-1725: Missing. 1726-1798: TQGPHSFQGT...AKNTFTQVVQ → MWTFVTQLLV...RVVRRRVFLK 1799-1873: Missing. | ||||||
| Note: Produced by alternative splicing of isoform Mu17. | ||||||
| Isoform Mu20 (identifier: P16157-20) Also known as: muscle-specific 4; The sequence of this isoform differs from the canonical sequence as follows: 1-1725: Missing. 1726-1798: TQGPHSFQGT...AKNTFTQVVQ → MWTFVTQLLV...LCFVLKHIHQ 1799-1881: GNEFQNIPGE...SKDHTSTPNP → VELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ | ||||||
| Note: Produced by alternative splicing of isoform Mu17. | ||||||
| Isoform Br21 (identifier: P16157-21) The sequence of this isoform differs from the canonical sequence as follows: 1-9: MPYSVGFRE → MAQAAKQLKKIKDIEAQALQEQKEKEESNRKRRNRSRDRKKK 820-820: E → EGTAHITIM 1849-1873: Missing. | ||||||
| Note: No experimental confirmation available. Produced by alternative splicing of isoform Er1. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 1881 | 1880 | Ankyrin-1 | PRO_0000066883 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 44 – 73 | 30 | ANK 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 77 – 106 | 30 | ANK 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 110 – 139 | 30 | ANK 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 143 – 172 | 30 | ANK 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 174 – 201 | 28 | ANK 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 205 – 234 | 30 | ANK 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 238 – 267 | 30 | ANK 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 271 – 300 | 30 | ANK 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 304 – 333 | 30 | ANK 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 337 – 366 | 30 | ANK 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 370 – 399 | 30 | ANK 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 403 – 432 | 30 | ANK 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 436 – 465 | 30 | ANK 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 469 – 498 | 30 | ANK 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 502 – 531 | 30 | ANK 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 535 – 564 | 30 | ANK 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 568 – 597 | 30 | ANK 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 601 – 630 | 30 | ANK 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 634 – 663 | 30 | ANK 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 667 – 696 | 30 | ANK 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 700 – 729 | 30 | ANK 21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 733 – 762 | 30 | ANK 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 766 – 795 | 30 | ANK 23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 911 – 1018 | 108 | ZU5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1403 – 1487 | 85 | Death | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 2 – 827 | 826 | 89 kDa domain | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1383 – 1881 | 499 | 55 kDa regulatory domain | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 834 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 856 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1073 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1684 | 1 | Phosphothreonine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1686 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 1725 | 1725 | Missing in isoform Mu17, isoform Mu18, isoform Mu19 and isoform Mu20. | VSP_018440 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 9 | 9 | MPYSVGFRE → MAQAAKQLKKIKDIEAQALQ EQKEKEESNRKRRNRSRDRK KK in isoform Br21. | VSP_018439 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 820 | 1 | E → EGTAHITIM in isoform Br21. | VSP_018441 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1513 – 1874 | 362 | Missing in isoform Er16. | VSP_000264 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1514 – 1675 | 162 | Missing in isoform Er2, isoform Er4, isoform Er6, isoform Er8, isoform Er10, isoform Er12 and isoform Er14. | VSP_018442 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1726 – 1798 | 73 | TQGPH…TQVVQ → MWTFVTQLLVTLVLLSFFLV SCQNVMHIVRGSLCFVLKHI HQELDKELGESEGLSDDEET ISPRVVRRRVFLK in isoform Mu17, isoform Mu18 and isoform Mu19. | VSP_018443 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1726 – 1798 | 73 | TQGPH…TQVVQ → MWTFVTQLLVTLVLLSFFLV SCQNVMHIVRGSLCFVLKHI HQ in isoform Mu20. | VSP_018444 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1799 – 1881 | 83 | GNEFQ…STPNP → VELRGSGLQPDLIEGRKGAQ IVKRASLKRGKQ in isoform Mu20. | VSP_018446 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1799 – 1873 | 75 | Missing in isoform Er9, isoform Er10 and isoform Mu19. | VSP_018445 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1827 – 1881 | 55 | IIRKV…STPNP → VELRGSGLQPDLIEGRKGAQ IVKRASLKRGKQ in isoform Er15 and isoform Mu18. | VSP_018448 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1827 – 1873 | 47 | Missing in isoform Er7 and isoform Er8. | VSP_018447 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1849 – 1873 | 25 | Missing in isoform Er3, isoform Er4 and isoform Br21. | VSP_018449 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1850 – 1881 | 32 | TVEGP…STPNP → ELRGSGLQPDLIEGRKGAQI VKRASLKRGKQ in isoform Er5, isoform Er6 and isoform Mu17. | VSP_000266 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1874 – 1881 | 8 | DHTSTPNP → VELRGSGLQPDLIEGRKGAQ IVKRASLKRGKQ in isoform Er11 and isoform Er12. | VSP_018450 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1874 – 1881 | 8 | DHTSTPNP → VLRRPRPWGTQRHHCCLALP GRLHDTSLHSPLYELSLQSL FSLVGSVSAPPCRSFRSSAC VLPVFAICPAFCLCCCLQVE LRGSGLQPDLIEGRKGAQIV KRASLKRGKQ in isoform Er13 and isoform Er14. | VSP_018451 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1875 | 1 | H → D in isoform Er16. | VSP_000265 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 21 | 1 | R → T. | VAR_000595 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 276 | 1 | L → R in SPH1. Ref.17 | VAR_054991 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 332 | 1 | D → H in a breast cancer sample; somatic mutation. Ref.18 | VAR_035605 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 463 | 1 | V → I in SPH1. Ref.16 | VAR_000596 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 619 | 1 | R → H in Brueggen. Corresponds to variant rs2304877 [ dbSNP | Ensembl ]. | VAR_000597 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 733 | 1 | L → I. Corresponds to variant rs11778936 [ dbSNP | Ensembl ]. | VAR_028769 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 750 | 1 | V → A. Ref.1 | VAR_000598 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 832 | 1 | R → Q. Corresponds to variant rs34523608 [ dbSNP | Ensembl ]. | VAR_061012 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 845 | 1 | D → E. | VAR_000599 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 991 | 1 | V → L. Ref.3 | VAR_026411 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1054 | 1 | I → T in SPH1. Ref.17 | VAR_054992 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1075 | 1 | T → I. Ref.1 Ref.2 Ref.3 Ref.5 Corresponds to variant rs35213384 [ dbSNP | Ensembl ]. | VAR_048263 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1126 | 1 | A → P. Corresponds to variant rs504465 [ dbSNP | Ensembl ]. | VAR_028770 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1192 | 1 | T → P. Corresponds to variant rs486770 [ dbSNP | Ensembl ]. | VAR_028771 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1286 | 1 | E → D. Ref.8 | VAR_000601 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1325 | 1 | M → V. Corresponds to variant rs10093583 [ dbSNP | Ensembl ]. | VAR_028772 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1392 | 1 | S → T. | VAR_000600 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1546 | 1 | V → I. Ref.2 Corresponds to variant rs1060130 [ dbSNP | Ensembl ]. | VAR_028773 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1592 | 1 | D → N in Duesseldorf. | VAR_000602 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1824 | 1 | T → P: Abolishes interaction with OBSCN (in isoform Mu17). Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1826 | 1 | K → E: Abolishes interaction with OBSCN (in isoform Mu17). Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1829 | 1 | R → G: Abolishes interaction with OBSCN (in isoform Mu17). Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 1830 | 1 | K → E: Abolishes interaction with OBSCN (in isoform Mu17). Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 230 | 1 | A → S in AAA51732. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 801 | 1 | K → L in AAB47805. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 845 | 1 | D → R AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 902 | 1 | I → T in AAB47805. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 407 – 414 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 417 – 425 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 433 – 435 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 440 – 447 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 450 – 459 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 473 – 480 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 483 – 492 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 506 – 513 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 516 – 524 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 539 – 545 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 549 – 557 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 572 – 578 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 582 – 588 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 589 – 591 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 605 – 611 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 615 – 623 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 638 – 644 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 648 – 655 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 656 – 658 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 671 – 678 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 681 – 690 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 704 – 710 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 715 – 722 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 737 – 743 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 747 – 755 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 765 – 767 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 770 – 776 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 780 – 789 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1398 – 1402 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1403 – 1414 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1415 – 1417 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1418 – 1424 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1429 – 1438 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1443 – 1458 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1459 – 1461 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1464 – 1473 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1477 – 1483 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Analysis of cDNA for human erythrocyte ankyrin indicates a repeated structure with homology to tissue-differentiation and cell-cycle control proteins." Lux S.E., John K.M., Bennett V. Nature 344:36-42(1990) [PubMed: 2137557] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ER1 AND ER2), PROTEIN SEQUENCE OF 3-30; 733-753; 828-871; 959-1003; 1106-1128; 1149-1168; 1282-1288; 1345-1367; 1383-1427; 1601-1626; 1686-1700 AND 1763-1772, VARIANTS ALA-750 AND ILE-1075. Tissue: Hematopoietic. |
| [2] | "cDNA sequence for human erythrocyte ankyrin." Lambert S., Yu H., Prchal J.T., Lawler J., Ruff P., Speicher D., Cheung M.C., Kan Y.W., Palek J. Proc. Natl. Acad. Sci. U.S.A. 87:1730-1734(1990) [PubMed: 1689849] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ER1; ER5 AND ER16), VARIANTS ILE-1075 AND ILE-1546. |
| [3] | "Structure and organization of the human ankyrin-1 gene. Basis for complexity of pre-mRNA processing." Gallagher P.G., Tse W.T., Scarpa A.L., Lux S.E., Forget B.G. J. Biol. Chem. 272:19220-19228(1997) [PubMed: 9235914] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, VARIANTS LEU-991 AND ILE-1075. |
| [4] | "An alternate promoter directs expression of a truncated, muscle-specific isoform of the human ankyrin 1 gene." Gallagher P.G., Forget B.G. J. Biol. Chem. 273:1339-1348(1998) [PubMed: 9430667] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS MU17; MU18; MU19 AND MU20), TISSUE SPECIFICITY, SUBCELLULAR LOCATION. Tissue: Skeletal muscle. |
| [5] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BR21), VARIANT ILE-1075. Tissue: Brain. |
| [6] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM MU17). Tissue: Skeletal muscle. |
| [8] | "Mapping the binding sites of human erythrocyte ankyrin for the anion exchanger and spectrin." Davis L.H., Bennett V. J. Biol. Chem. 265:10589-10596(1990) [PubMed: 2141335] [Abstract] Cited for: PROTEIN SEQUENCE OF 5-12; 403-422; 797-814; 862-877 AND 899-912, DOMAINS SPTB AND SLC4A1 BINDING, VARIANT ASP-1286. |
| [9] | "The hydrophilic domain of small ankyrin-1 interacts with the two N-terminal immunoglobulin domains of titin." Kontrogianni-Konstantopoulos A., Bloch R.J. J. Biol. Chem. 278:3985-3991(2003) [PubMed: 12444090] [Abstract] Cited for: INTERACTION WITH TTN. |
| [10] | "Binding of an ankyrin-1 isoform to obscurin suggests a molecular link between the sarcoplasmic reticulum and myofibrils in striated muscles." Bagnato P., Barone V., Giacomello E., Rossi D., Sorrentino V. J. Cell Biol. 160:245-253(2003) [PubMed: 12527750] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH OBSCN, MUTAGENESIS OF THR-1824; LYS-1826; ARG-1829 AND LYS-1830. |
| [11] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1684 AND SER-1686, MASS SPECTROMETRY. Tissue: Platelet. |
| [12] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed: 19367720] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1686, MASS SPECTROMETRY. Tissue: T-cell. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-834, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Crystal structure of a 12 ANK repeat stack from human ankyrinR." Michaely P., Tomchick D.R., Machius M., Anderson R.G. EMBO J. 21:6387-6396(2002) [PubMed: 12456646] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 402-827, FUNCTION OF ANK REPEAT DOMAIN. |
| [15] | "Solution structure of the DEATH domain of ankyrin-1." RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1392-1497. |
| [16] | "Ankyrin-1 mutations are a major cause of dominant and recessive hereditary spherocytosis." Eber S.W., Gonzalez J.M., Lux M.L., Scarpa A.L., Tse W.T., Dornwell M., Herbers J., Kugler W., Oezcan R., Pekrun A., Gallagher P.G., Schroeter W., Forget B.G., Lux S.E. Nat. Genet. 13:214-218(1996) [PubMed: 8640229] [Abstract] Cited for: VARIANT SPH1 ILE-463. |
| [17] | "Low frequency of ankyrin mutations in hereditary spherocytosis: identification of three novel mutations." Leite R.C.A., Basseres D.S., Ferreira J.S., Alberto F.L., Costa F.F., Saad S.T.O. Hum. Mutat. 16:529-529(2000) [PubMed: 11102985] [Abstract] Cited for: VARIANTS SPH1 ARG-276 AND THR-1054. |
| [18] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-332. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Ankyrin entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X16609 mRNA. Translation: CAA34610.1. X16609 mRNA. Translation: CAA34611.1. M28880 mRNA. Translation: AAA51732.1. U50133 U50132 Genomic DNA. Translation: AAB47805.1. Sequence problems.AF005213 mRNA. Translation: AAC01950.1. AB209418 mRNA. Translation: BAD92655.1. AC113133 Genomic DNA. No translation available. BC030957 mRNA. Translation: AAH30957.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00007623. IPI00007625. IPI00216697. IPI00297532. IPI00374973. IPI00646300. IPI00654646. IPI00743884. IPI00744408. IPI00744846. IPI00744895. IPI00744986. IPI00745348. IPI00747536. IPI00747552. IPI00748074. IPI00748154. IPI00748330. IPI00748439. IPI00748895. IPI00749301. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | A35049. SJHUK. S08275. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000028.3. NM_000037.3. NP_001135918.1. NM_001142446.1. NP_065208.2. NM_020475.2. NP_065209.2. NM_020476.2. NP_065210.2. NM_020477.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.654438. Hs.667377. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P16157. | ||||||||||||||||||||||||||||||||||||||||||
| SMR | P16157. Positions 10-812, 911-1068, 1400-1497. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | P16157. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-254860. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | P16157. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P16157. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 116241246. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P16157. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000347528; ENSP00000339620; ENSG00000029534. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 286. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:286. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003xoi.1. human. uc003xoj.1. human. uc003xok.1. human. uc003xol.1. human. uc003xom.1. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 286. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M041510. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:492. ANK1. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB016057. HPA004842. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 182900. phenotype. 612641. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P16157. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 251066. 8p11.2 deletion syndrome. 822. Hereditary spherocytosis. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG004234. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG418BMG. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P16157. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P16157. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P16157. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ANK1. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P16157. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000029534. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR000488. Death. IPR011029. DEATH-like. IPR000906. ZU5. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.25.40.20. ANK. 3 hits. G3DSA:1.10.533.10. DEATH_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K10380. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00023. Ank. 19 hits. PF00531. Death. 1 hit. PF00791. ZU5. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01415. ANKYRIN. | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00248. ANK. 23 hits. SM00005. DEATH. 1 hit. SM00218. ZU5. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF48403. ANK. 2 hits. SSF47986. DEATH_like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 20 hits. PS50017. DEATH_DOMAIN. 1 hit. PS51145. ZU5. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 1155. | ||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P16157. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ANK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P16157 Secondary accession number(s): A6NJ23 Q99407 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with