P16144 (ITB4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 175.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Integrin beta-4 Alternative name(s): GP150 CD_antigen=CD104 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1822 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Integrin alpha-6/beta-4 is a receptor for laminin. Plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. Ref.15 Ref.19 |
| Subunit structure | Heterodimer of an alpha and a beta subunit. Beta-4 associates with alpha-6. Interacts (via cytoplasmic region) with COL17A1 (via cytoplasmic region). Interacts (via cytoplasmic region) with DST isoform 3 (via N-terminus). Isoform beta-4a interacts (via cytoplasmic domain) with DST (via N-terminus). Interacts with RAC1. Ref.13 Ref.14 Ref.15 Ref.19 |
| Subcellular location | Membrane; Single-pass type I membrane protein. Cell junction › hemidesmosome. Note: Colocalizes with DST at the leading edge of migrating keratinocytes. Ref.15 Ref.19 |
| Tissue specificity | Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoform beta-4D is also expressed in colon and placenta. Isoform beta-4E is also expressed in epidermis, lung, duodenum, heart, spleen and stomach. |
| Domain | The fibronectin type-III-like domains bind BPAG1 and plectin and probably also recruit BP230. |
| Involvement in disease | Epidermolysis bullosa letalis, with pyloric atresia (EB-PA) [MIM:226730]: An autosomal recessive, frequently lethal, epidermolysis bullosa with variable involvement of skin, nails, mucosa, and with variable effects on the digestive system. It is characterized by mucocutaneous fragility, aplasia cutis congenita, and gastrointestinal atresia, which most commonly affects the pylorus. Pyloric atresia is a primary manifestation rather than a scarring process secondary to epidermolysis bullosa. Generalized atrophic benign epidermolysis bullosa (GABEB) [MIM:226650]: A non-lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities. |
| Sequence similarities | Belongs to the integrin beta chain family. Contains 1 Calx-beta domain. Contains 4 fibronectin type-III domains. Contains 1 PSI domain. Contains 1 VWFA domain. |
| Sequence caution | The sequence CAA37656.1 differs from that shown. Reason: Frameshift at positions 1413 and 1429. The sequence CAA37656.1 differs from that shown. Reason: Frameshift at positions 1414 and 1429. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ARRDC3 | Q96B67 | 3 | EBI-948678,EBI-2875665 | |
| Cadm1 | Q8R5M8-2 | 3 | EBI-948678,EBI-5651941 | From a different organism. |
| ITGA6 | P23229 | 3 | EBI-948678,EBI-2436548 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Beta-4C (identifier: P16144-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta-4A (identifier: P16144-2) The sequence of this isoform differs from the canonical sequence as follows: 1370-1439: Missing. | ||||||
| Isoform Beta-4B (identifier: P16144-3) The sequence of this isoform differs from the canonical sequence as follows: 1370-1439: Missing. 1519-1519: H → HGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIILAGRPAAPSWGP | ||||||
| Isoform Beta-4D (identifier: P16144-4) The sequence of this isoform differs from the canonical sequence as follows: 1370-1439: Missing. 1678-1685: CEMAQGGG → W | ||||||
| Isoform Beta-4E (identifier: P16144-5) The sequence of this isoform differs from the canonical sequence as follows: 851-964: LNEVYRQISG...DDEKQLLVEA → VRTQELGLAG...GRTGAPLYPA 965-1822: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 28 – 1822 | 1795 | Integrin beta-4 | PRO_0000016346 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 28 – 710 | 683 | Extracellular Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 711 – 733 | 23 | Helical; Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 734 – 1822 | 1089 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 29 – 73 | 45 | PSI | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 131 – 329 | 199 | VWFA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 456 – 502 | 47 | I | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 503 – 542 | 40 | II | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 543 – 581 | 39 | III | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 582 – 619 | 38 | IV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 979 – 1084 | 106 | Calx-beta | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1126 – 1215 | 90 | Fibronectin type-III 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1220 – 1318 | 99 | Fibronectin type-III 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1528 – 1618 | 91 | Fibronectin type-III 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1641 – 1734 | 94 | Fibronectin type-III 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 456 – 619 | 164 | Cysteine-rich tandem repeats | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1530 | 1 | Phosphothreonine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 327 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 491 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 579 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 617 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 695 | 1 | N-linked (GlcNAc...) Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 30 ↔ 455 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 38 ↔ 48 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 41 ↔ 72 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 51 ↔ 61 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 245 ↔ 288 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 424 ↔ 671 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 452 ↔ 457 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 468 ↔ 479 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 476 ↔ 512 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 481 ↔ 490 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 492 ↔ 503 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 518 ↔ 523 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 520 ↔ 551 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 525 ↔ 536 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 557 ↔ 562 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 564 ↔ 573 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 575 ↔ 582 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 596 ↔ 601 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 598 ↔ 648 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 603 ↔ 614 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 626 ↔ 635 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 632 ↔ 706 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 651 ↔ 680 | By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 851 – 964 | 114 | LNEVY…LLVEA → VRTQELGLAGDVAERGLQAD LRCTQAPADQVPAAAQCREK ARPHHCGHSADGAPLGQAGP AEAYREAGGTEGLPRPQGGP RLLHPHCRPGRPGHGGVPGG RGAGGRTGAPLYPA in isoform Beta-4E. | VSP_002747 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 965 – 1822 | 858 | Missing in isoform Beta-4E. | VSP_002748 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1370 – 1439 | 70 | Missing in isoform Beta-4A, isoform Beta-4B and isoform Beta-4D. | VSP_002749 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1519 | 1 | H → HGLPPIWEHGRSRLPLSWAL GSRSRAQMKGFPPSRGPRDS IILAGRPAAPSWGP in isoform Beta-4B. | VSP_002750 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1678 – 1685 | 8 | CEMAQGGG → W in isoform Beta-4D. | VSP_002751 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 38 | 1 | C → R in EB-PA; mild form. Ref.27 | VAR_010652 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 61 | 1 | C → Y in EB-PA; lethal form. Ref.24 | VAR_004006 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 98 | 1 | R → H. Ref.31 | VAR_011292 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 131 | 1 | D → Y in EB-PA; lethal form. Ref.32 | VAR_011293 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 156 | 1 | L → P in EB-PA; mild form. Ref.26 | VAR_004007 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 245 | 1 | C → G in EB-PA; lethal form. Ref.25 | VAR_004008 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | R → C in EB-PA; mild form. Ref.24 Ref.32 | VAR_004009 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | G → D in EB-PA; lethal form. Ref.32 | VAR_011294 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 283 | 1 | R → C in EB-PA. Ref.32 | VAR_011295 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 325 | 1 | V → D in EB-PA. Ref.32 | VAR_011296 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 336 | 1 | L → P in EB-PA; mild form. Ref.32 | VAR_011297 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 478 | 1 | Q → H. Corresponds to variant rs8079267 [ dbSNP | Ensembl ]. | VAR_027803 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 562 | 1 | C → R in EB-PA; mild form. Ref.24 | VAR_004010 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 844 | 1 | R → L. Ref.31 | VAR_011298 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 931 | 1 | G → D in GABEB. Ref.29 | VAR_011299 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1216 | 1 | H → Q. Ref.32 | VAR_011300 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1225 | 1 | R → H in EB-PA; mild form. Ref.32 | VAR_011301 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1281 | 1 | R → W in EB-PA; mild form; abolishes interaction with PLEC and reduces interaction with COL17A1. Ref.15 Ref.24 Ref.28 | VAR_004011 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1764 | 1 | T → S. Ref.4 Ref.5 Corresponds to variant rs1051486 [ dbSNP | Ensembl ]. | VAR_055971 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1779 | 1 | L → P. Ref.1 Ref.2 Ref.4 Ref.5 Ref.7 Corresponds to variant rs871443 [ dbSNP | Ensembl ]. | VAR_027804 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 27 | 1 | Missing in CAB61345. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 43 | 1 | R → Y AA sequence Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 46 | 1 | K → P AA sequence Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 621 – 704 | 84 | IHPGL…VHKKK → STRASARTYAPACSARRGAP ARRRGARVRNATSRSRWWTS LREARRWWCAAPSGTRMTTA PTATPWKVTAPLGPTALSWC TRRR in CAB61345. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 802 – 804 | 3 | GFA → WLC in AAB65422. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1414 – 1429 | 16 | HGPPD…KGGSL → TAPRTTAARAGRAAAV in CAA37656. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1777 | 1 | Missing in CAB61345. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 990 – 995 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 997 – 1002 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1003 – 1005 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1006 – 1016 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1022 – 1033 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1035 – 1037 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1043 – 1048 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1054 – 1061 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1076 – 1087 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1096 – 1103 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1131 – 1137 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1139 – 1141 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1143 – 1148 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1156 – 1163 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1168 – 1170 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1172 – 1183 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1191 – 1200 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1203 – 1207 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1211 – 1214 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1227 – 1230 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1232 – 1234 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1236 – 1239 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1252 – 1260 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1262 – 1264 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1266 – 1268 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1271 – 1275 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1282 – 1286 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1294 – 1302 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1310 – 1314 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1316 – 1318 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1334 – 1336 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1522 – 1524 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1543 – 1547 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1557 – 1569 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1572 – 1578 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1584 – 1589 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1595 – 1606 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1608 – 1617 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Amino acid sequence of a novel integrin beta 4 subunit and primary expression of the mRNA in epithelial cells." Suzuki S., Naitoh Y. EMBO J. 9:757-763(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA-4A), VARIANT PRO-1779. |
| [2] | "Cloning and sequence analysis of beta-4 cDNA: an integrin subunit that contains a unique 118 kd cytoplasmic domain." Hogervorst F., Kuikman I., von Dem Borne A.E.G.K., Sonnenberg A. EMBO J. 9:765-770(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA-4B), VARIANT PRO-1779. |
| [3] | "Epithelial integrin alpha 6 beta 4: complete primary structure of alpha 6 and variant forms of beta 4." Tamura R.N., Rozzo C., Starr L., Chambers J., Reichardt L.F., Cooper H.M., Quaranta V. J. Cell Biol. 111:1593-1604(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA-4C). Tissue: Pancreas. |
| [4] | "Genomic organization of the integrin beta 4 gene (ITGB4): a homozygous splice-site mutation in a patient with junctional epidermolysis bullosa associated with pyloric atresia." Pulkkinen L., Kurtz K.S., Xu Y., Bruckner-Tuderman L., Uitto J. Lab. Invest. 76:823-833(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS BETA-4A; BETA-4B AND BETA-4C), VARIANTS SER-1764 AND PRO-1779. |
| [5] | "Genomic organization of the human integrin beta 4 gene." Iacovacci S., Gagnoux-Palacios L., Zambruno G., Meneguzzi G., D'Alessio M. Mamm. Genome 8:448-450(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS BETA-4A; BETA-4B AND BETA-4C), VARIANTS SER-1764 AND PRO-1779. Tissue: Lung. |
| [6] | D'Alessio M. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [7] | "The unique cytoplasmic domain of the human integrin variant beta4E is produced by partial retention of intronic sequences." van Leusden M.R., Kuikman I., Sonnenberg A. Biochem. Biophys. Res. Commun. 235:826-830(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM BETA-4E), VARIANT PRO-1779. |
| [8] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM BETA-4A). Tissue: Cerebellum. |
| [11] | "A novel integrin (alpha E beta 4) from human epithelial cells suggests a fourth family of integrin adhesion receptors." Kajiji S., Tamura R.N., Quaranta V. EMBO J. 8:673-680(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 28-46. |
| [12] | "A novel structural variant of the human beta 4 integrin cDNA." Clarke A.S., Lotz M.M., Mercurio A.M. Cell Adhes. Commun. 2:1-6(1994) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM BETA-4D). |
| [13] | "The N terminus of the transmembrane protein BP180 interacts with the N-terminal domain of BP230, thereby mediating keratin cytoskeleton anchorage to the cell surface at the site of the hemidesmosome." Hopkinson S.B., Jones J.C. Mol. Biol. Cell 11:277-286(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DSP. |
| [14] | "The hemidesmosomal protein bullous pemphigoid antigen 1 and the integrin beta 4 subunit bind to ERBIN. Molecular cloning of multiple alternative splice variants of ERBIN and analysis of their tissue expression." Favre B., Fontao L., Koster J., Shafaatian R., Jaunin F., Saurat J.-H., Sonnenberg A., Borradori L. J. Biol. Chem. 276:32427-32436(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DST. |
| [15] | "Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly." Koster J., Geerts D., Favre B., Borradori L., Sonnenberg A. J. Cell Sci. 116:387-399(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH COL17A1 AND DST, CHARACTERIZATION OF VARIANT TRP-1281, SUBCELLULAR LOCATION. |
| [16] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-695, MASS SPECTROMETRY. Tissue: Plasma. |
| [17] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1530, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [19] | "BPAG1e maintains keratinocyte polarity through beta4 integrin-mediated modulation of Rac1 and cofilin activities." Hamill K.J., Hopkinson S.B., DeBiase P., Jones J.C. Mol. Biol. Cell 20:2954-2962(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RAC1, SUBCELLULAR LOCATION. |
| [20] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [21] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [22] | "Crystal structure of a tandem pair of fibronectin type III domains from the cytoplasmic tail of integrin alpha6beta4." de Pereda J.M., Wiche G., Liddington R.C. EMBO J. 18:4087-4095(1999) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 1126-1320. |
| [23] | "Solution structure of the fibronectin type III domain of human integrin beta-4." RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1515-1622. |
| [24] | "Novel ITGB4 mutations in lethal and nonlethal variants of epidermolysis bullosa with pyloric atresia: missense versus nonsense." Pulkkinen L., Rouan F., Bruckner-Tuderman L., Wallerstein R., Garzon M., Brown T., Smith L., Carter W.G., Uitto J. Am. J. Hum. Genet. 63:1376-1387(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EB-PA TYR-61; CYS-252; ARG-562 AND TRP-1281. |
| [25] | "Epidermolysis bullosa with pyloric atresia: novel mutations in the beta-4 integrin gene (ITGB4)." Pulkkinen L., Kim D.U., Uitto J. Am. J. Pathol. 152:157-166(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EB-PA GLY-245. |
| [26] | "Compound heterozygosity for missense (L156P) and nonsense (R554X) mutations in the beta-4 integrin gene (ITGB4) underlies mild, nonlethal phenotype of epidermolysis bullosa with pyloric atresia." Pulkkinen L., Bruckner-Tuderman L., August C., Uitto J. Am. J. Pathol. 152:935-941(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EB-PA PRO-156. |
| [27] | "Pyloric atresia-junctional epidermolysis bullosa syndrome: mutations in the integrin beta4 gene (ITGB4) in two unrelated patients with mild disease." Mellerio J.E., Pulkkinen L., McMillan J.R., Lake B.D., Horn H.M., Tidman M.J., Harper J.I., McGrath J.A., Uitto J., Eady R.A.J. Br. J. Dermatol. 139:862-871(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EB-PA ARG-38. |
| [28] | "Congenital focal segmental glomerulosclerosis associated with beta4 integrin mutation and epidermolysis bullosa." Kambham N., Tanji N., Seigle R.L., Markowitz G.S., Pulkkinen L., Uitto J., D'Agati V.D. Am. J. Kidney Dis. 36:190-196(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EB-PA TRP-1281. |
| [29] | "A homozygous missense mutation in the cytoplasmic tail of beta4 integrin, G931D, that disrupts hemidesmosome assembly and underlies non-Herlitz junctional epidermolysis bullosa without pyloric atresia?" Inoue M., Tamai K., Shimizu H., Owaribe K., Nakama T., Hashimoto T., McGrath J.A. J. Invest. Dermatol. 114:1061-1064(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GABEB ASP-931. |
| [30] | "Alpha 6 beta 4 integrin abnormalities in junctional epidermolysis bullosa with pyloric atresia." Ashton G.H.S., Sorelli P., Mellerio J.E., Keane F.M., Eady R.A.J., McGrath J.A. Br. J. Dermatol. 144:408-414(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EB-PA. |
| [31] | "Nine novel single-nucleotide polymorphisms in the integrin beta4 (ITGB4) gene in the Japanese population." Hirano A., Nagai H., Harada H., Terada Y., Haga S., Kajiwara T., Emi M. J. Hum. Genet. 46:35-37(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HIS-98 AND LEU-844. |
| [32] | "Epidermolysis bullosa with congenital pyloric atresia: novel mutations in the beta 4 integrin gene (ITGB4) and genotype/phenotype correlations." Nakano A., Pulkkinen L., Murrell D., Rico J., Lucky A.W., Garzon M., Stevens C.A., Robertson S., Pfendner E., Uitto J. Pediatr. Res. 49:618-626(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS EB-PA TYR-131; CYS-252; ASP-273; CYS-283; ASP-325; PRO-336 AND HIS-1225, VARIANT GLN-1216. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X51841 mRNA. Translation: CAA36134.1. X52186 mRNA. Translation: CAA36433.1. X53587 mRNA. Translation: CAA37656.1. Frameshift. U66541 U66540 Genomic DNA. Translation: AAC51634.1.U66541 U66540 Genomic DNA. Translation: AAC51633.1.U66541 U66540 Genomic DNA. Translation: AAC51632.1.AC087749 Genomic DNA. No translation available. CH471099 Genomic DNA. Translation: EAW89305.1. BC126411 mRNA. Translation: AAI26412.1. AJ251004, Y11107 Genomic DNA. Translation: CAB61345.1. AF011375 mRNA. Translation: AAB65421.1. AF011376 Genomic DNA. Translation: AAB65422.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00027422. IPI00220845. IPI00220846. IPI00220847. IPI00220848. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | JC5545. A36429. S12380. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000204.3. NM_000213.3. NP_001005619.1. NM_001005619.1. NP_001005731.1. NM_001005731.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.632226. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P16144. Positions 989-1107, 1126-1339, 1519-1622. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P16144. 24 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-5004072. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000200181. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 13638154. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000200181; ENSP00000200181; ENSG00000132470. ENST00000339591; ENSP00000344079; ENSG00000132470. ENST00000449880; ENSP00000400217; ENSG00000132470. ENST00000450894; ENSP00000405536; ENSG00000132470. ENST00000579662; ENSP00000463651; ENSG00000132470. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3691. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:3691. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002jpg.3. human. uc002jpj.3. human. uc010dgo.3. human. uc010dgp.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 3691. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC17P073717. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0039036. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6158. ITGB4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB002422. CAB005258. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 147557. gene. 226650. phenotype. 226730. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 79402. Generalized junctional epidermolysis bullosa, non-Herlitz type. 79403. Junctional epidermolysis bullosa - pyloric atresia. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA29957. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG303049. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000231105. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG006189. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K06525. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | EDDDCTY. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | a6b1_a6b4_integrin_pathway. a6b1 and a6b4 Integrin signaling. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_111155. Cell-Cell communication. REACT_118779. Extracellular matrix organization. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ITGB4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000132470. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.60.40.10. 4 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR003644. Calx_beta. IPR013032. EGF-like_CS. IPR013111. EGF_extracell. IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. IPR015812. Integrin_bsu. IPR012013. Integrin_bsu-4. IPR002369. Integrin_bsu_N. IPR012896. Integrin_bsu_tail. IPR003659. Plexin-like. IPR016201. Plexin-like_fold. IPR002035. VWF_A. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR10082. PTHR10082. 1 hit. PTHR10082:SF6. PTHR10082:SF6. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF03160. Calx-beta. 1 hit. PF07974. EGF_2. 1 hit. PF00041. fn3. 4 hits. PF07965. Integrin_B_tail. 1 hit. PF00362. Integrin_beta. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF002513. Integrin_B4. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01186. INTEGRINB. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00237. Calx_beta. 1 hit. SM00060. FN3. 4 hits. SM00187. INB. 1 hit. SM00423. PSI. 1 hit. SM00327. VWA. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49265. FN_III-like. 4 hits. SSF69687. Integrin_bsu_tail. 1 hit. SSF103575. Plexin-like_fold. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00022. EGF_1. 2 hits. Uncertain. PS01186. EGF_2. 2 hits. Uncertain. PS50853. FN3. 4 hits. PS00243. INTEGRIN_BETA. 2 hits. PS50234. VWFA. False negative. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | ITGB4. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P16144. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 3691. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 14457. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ITB4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P16144 Secondary accession number(s): A0AVL6 Q9UIQ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
