Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mucin-1

Gene

MUC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.
The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.

GO - Molecular functioni

  • p53 binding Source: BHF-UCL
  • RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: BHF-UCL
  • transcription cofactor activity Source: BHF-UCL

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-5083625. Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC).
R-HSA-5083632. Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS).
R-HSA-5083636. Defective GALNT12 causes colorectal cancer 1 (CRCS1).
R-HSA-913709. O-linked glycosylation of mucins.
R-HSA-977068. Termination of O-glycan biosynthesis.
SIGNORiP15941.

Protein family/group databases

MEROPSiS71.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Mucin-1
Short name:
MUC-1
Alternative name(s):
Breast carcinoma-associated antigen DF3
Cancer antigen 15-3
Short name:
CA 15-3
Carcinoma-associated mucin
Episialin
H23AG
Krebs von den Lungen-6
Short name:
KL-6
PEMT
Peanut-reactive urinary mucin
Short name:
PUM
Polymorphic epithelial mucin
Short name:
PEM
Tumor-associated epithelial membrane antigen
Short name:
EMA
Tumor-associated mucin
CD_antigen: CD227
Cleaved into the following 2 chains:
Mucin-1 subunit alpha
Short name:
MUC1-NT
Short name:
MUC1-alpha
Mucin-1 subunit beta
Short name:
MUC1-beta
Alternative name(s):
MUC1-CT
Gene namesi
Name:MUC1
Synonyms:PUM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:7508. MUC1.

Subcellular locationi

Mucin-1 subunit beta :
  • Cell membrane
  • Cytoplasm
  • Nucleus

  • Note: On EGF and PDGFRB stimulation, transported to the nucleus through interaction with CTNNB1, a process which is stimulated by phosphorylation. On HRG stimulation, colocalizes with JUP/gamma-catenin at the nucleus.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 11581135ExtracellularSequence analysisAdd
BLAST
Transmembranei1159 – 118123HelicalSequence analysisAdd
BLAST
Topological domaini1182 – 125574CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • apical plasma membrane Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: UniProtKB
  • Golgi lumen Source: Reactome
  • integral component of plasma membrane Source: ProtInc
  • nuclear chromatin Source: BHF-UCL
  • vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus, Secreted

Pathology & Biotechi

Involvement in diseasei

MUC1/CA 15-3 is used as a serological clinical marker of breast cancer to monitor response to breast cancer treatment and disease recurrence (PubMed:20816948). Decreased levels over time may be indicative of a positive response to treatment. Conversely, increased levels may indicate disease progression. At an early stage disease, only 21% of patients exhibit high MUC1/CA 15-3 levels, that is why CA 15-3 is not a useful screening test. Most antibodies target the highly immunodominant core peptide domain of 20 amino acid (APDTRPAPGSTAPPAHGVTS) tandem repeats. Some antibodies recognize glycosylated epitopes.

Medullary cystic kidney disease 1 (MCKD1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of tubulointerstitial nephropathy characterized by formation of renal cysts at the corticomedullary junction. It is characterized by adult onset of impaired renal function and salt wasting resulting in end-stage renal failure by the sixth decade.
See also OMIM:174000

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1098 – 10981S → A, D, E, F, G, H, I, K, L, M, N, P, Q, R, V, W or Y: Completely abrogates cleavage. 1 Publication
Mutagenesisi1098 – 10981S → C or T: Almost complete cleavage. 1 Publication
Mutagenesisi1116 – 11161D → A: Greatly reduced formation of isoform 5/isoform Y complex. 1 Publication
Mutagenesisi1116 – 11161D → E: No effect on formation of isoform 5/isoform Y complex. 1 Publication
Mutagenesisi1184 – 11841C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited and AP1S1 binding reduced by 30%; when associated with C-1186. Accumulates in intracellular compartments; when associated with C-1186 and N-1203. 1 Publication
Mutagenesisi1186 – 11861C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited, and AP1S1 binding reduced by 30%; when associated with C-1184. Accumulates in intracellular compartments; when associated with C-1184 and N-1203. 1 Publication
Mutagenesisi1187 – 11893RRK → AAA: No nuclear targeting of HRG-stimulated MUC1 C-terminal nor JUP/gamma-catenin. No effect on interaction with JUP/gamma-catenin. 2 Publications
Mutagenesisi1187 – 11893RRK → QQQ: No effect on palmitoylation. 2 Publications
Mutagenesisi1191 – 11911Y → F: No effect on EGFR-mediated phosphorylation. 2 Publications
Mutagenesisi1191 – 11911Y → N: No effect on endocytosis. 2 Publications
Mutagenesisi1203 – 12031Y → E: No effect on nuclear colocalization of MUC1CT and CTNNB1. No effect on in vitro PDFGR-induced cell invasiveness. 4 Publications
Mutagenesisi1203 – 12031Y → F: No effect on EGFR-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-induced cell invasiveness. 4 Publications
Mutagenesisi1203 – 12031Y → N: Reduced endocytosis by 30%. Greatly reduced binding to AP1S2 and GRB2. Binding AP1S1 reduced by 25%. Reduced endocytosis by 77%; when associated with N-1243. Accumulates in intracellular compartments; when associated with C-1184 and C-1186. 4 Publications
Mutagenesisi1209 – 12091Y → F: Some reduction in EGFR-mediated phosphorylation. 1 Publication
Mutagenesisi1218 – 12181Y → F: No effect on EGFR-mediated phosphorylation. No nuclear colocalization of MUC1CT and CTNNB1. 2 Publications
Mutagenesisi1223 – 12231S → A: No change in PRKCD- nor GSK3B-mediated phosphorylation. 2 Publications
Mutagenesisi1224 – 12241T → A: Loss of PRKCD-mediated phosphorylation. Decreased PRKCD binding. No increased binding to CTNNB1 in the presence of autophosphorylated PRKCD. Increases formation of E-cadherin/beta-catenin complex. 1 Publication
Mutagenesisi1227 – 12271S → A: No change in PRKCD-mediated phosphorylation. Loss of GSK3B-mediated phosphorylation. CTNNB1. 2 Publications
Mutagenesisi1229 – 12291Y → F: Greatly reduced EGFR- and Src-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-mediated phosphorylation. Decreased Src-binding. 4 Publications
Mutagenesisi1229 – 12291Y → N: No effect on endocytosis. 4 Publications
Mutagenesisi1243 – 12431Y → N: Reduces binding to AP1S2 by 33%. Greatly reduced binding to GRB2. Reduced endocytosis by 50%. Reduced endocytosis by 77%; when associated with N-1203. 1 Publication

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

MalaCardsiMUC1.
MIMi174000. phenotype.
Orphaneti34149. Autosomal dominant medullary cystic kidney disease with or without hyperuricemia.
PharmGKBiPA31309.

Polymorphism and mutation databases

BioMutaiMUC1.
DMDMi296439295.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 23232 PublicationsAdd
BLAST
Chaini24 – 12551232Mucin-1PRO_0000019277Add
BLAST
Chaini24 – 10971074Mucin-1 subunit alphaPRO_0000317446Add
BLAST
Chaini1098 – 1255158Mucin-1 subunit betaPRO_0000317447Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi131 – 1311O-linked (GalNAc...)2 Publications
Glycosylationi139 – 1391O-linked (GalNAc...)2 Publications
Glycosylationi140 – 1401O-linked (GalNAc...)Sequence analysis
Glycosylationi144 – 1441O-linked (GalNAc...)Sequence analysis
Glycosylationi957 – 9571N-linked (GlcNAc...)Sequence analysis
Glycosylationi975 – 9751N-linked (GlcNAc...)Sequence analysis
Glycosylationi1029 – 10291N-linked (GlcNAc...)Sequence analysis
Glycosylationi1055 – 10551N-linked (GlcNAc...)Sequence analysis
Glycosylationi1133 – 11331N-linked (GlcNAc...)Sequence analysis
Lipidationi1184 – 11841S-palmitoyl cysteine1 Publication
Lipidationi1186 – 11861S-palmitoyl cysteine1 Publication
Modified residuei1203 – 12031Phosphotyrosine; by PDGFR2 Publications
Modified residuei1212 – 12121Phosphotyrosine1 Publication
Modified residuei1218 – 12181Phosphotyrosine; by PDGFR1 Publication
Modified residuei1224 – 12241Phosphothreonine; by PKC/PRKCD1 Publication
Modified residuei1227 – 12271Phosphoserine; by GSK3-betaCombined sources1 Publication
Modified residuei1229 – 12291Phosphotyrosine; by CSK, EGFR and SRC4 Publications
Modified residuei1243 – 12431Phosphotyrosine1 Publication

Post-translational modificationi

Highly glycosylated (N- and O-linked carbohydrates and sialic acid). O-glycosylated to a varying degree on serine and threonine residues within each tandem repeat, ranging from mono- to penta-glycosylation. The average density ranges from about 50% in human milk to over 90% in T47D breast cancer cells. Further sialylation occurs during recycling. Membrane-shed glycoproteins from kidney and breast cancer cells have preferentially sialyated core 1 structures, while secreted forms from the same tissues display mainly core 2 structures. The O-glycosylated content is overlapping in both these tissues with terminal fucose and galactose, 2- and 3-linked galactose, 3- and 3,6-linked GalNAc-ol and 4-linked GlcNAc predominating. Differentially O-glycosylated in breast carcinomas with 3,4-linked GlcNAc. N-glycosylation consists of high-mannose, acidic complex-type and hybrid glycans in the secreted form MUC1/SEC, and neutral complex-type in the transmembrane form, MUC1/TM.4 Publications
Proteolytic cleavage in the SEA domain occurs in the endoplasmic reticulum by an autoproteolytic mechanism and requires the full-length SEA domain as well as requiring a Ser, Thr or Cys residue at the P + 1 site. Cleavage at this site also occurs on isoform MUC1/X but not on isoform MUC1/Y. Ectodomain shedding is mediated by ADAM17.3 Publications
Dual palmitoylation on cysteine residues in the CQC motif is required for recycling from endosomes back to the plasma membrane.1 Publication
Phosphorylated on tyrosines and serine residues in the C-terminal. Phosphorylation on tyrosines in the C-terminal increases the nuclear location of MUC1 and beta-catenin. Phosphorylation by PKC delta induces binding of MUC1 to beta-catenin/CTNNB1 and thus decreases the formation of the beta-catenin/E-cadherin complex. Src-mediated phosphorylation inhibits interaction with GSK3B. Src- and EGFR-mediated phosphorylation on Tyr-1229 increases binding to beta-catenin/CTNNB1. GSK3B-mediated phosphorylation on Ser-1227 decreases this interaction but restores the formation of the beta-cadherin/E-cadherin complex. On T-cell receptor activation, phosphorylated by LCK. PDGFR-mediated phosphorylation increases nuclear colocalization of MUC1CT and CTNNB1.11 Publications
The N-terminal sequence has been shown to begin at position 24 or 28.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei1097 – 10982Cleavage; by autolysis

Keywords - PTMi

Autocatalytic cleavage, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiP15941.
PaxDbiP15941.
PeptideAtlasiP15941.
PRIDEiP15941.

PTM databases

iPTMnetiP15941.
PhosphoSiteiP15941.
SwissPalmiP15941.
UniCarbKBiP15941.

Expressioni

Tissue specificityi

Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform Y is expressed in tumor cells only.2 Publications

Developmental stagei

During fetal development, expressed at low levels in the colonic epithelium from 13 weeks of gestation.1 Publication

Gene expression databases

BgeeiENSG00000185499.
ExpressionAtlasiP15941. baseline and differential.
GenevisibleiP15941. HS.

Organism-specific databases

HPAiCAB000036.
CAB001986.
HPA004179.
HPA007235.
HPA008855.

Interactioni

Subunit structurei

The alpha subunit forms a tight, non-covalent heterodimeric complex with the proteolytically-released beta-subunit. Interaction, via the tandem repeat region, with domain 1 of ICAM1 is implicated in cell migration and metastases. Isoform 1 binds directly the SH2 domain of GRB2, and forms a MUC1/GRB2/SOS1 complex involved in RAS signaling. The cytoplasmic tail (MUC1CT) interacts with several proteins such as SRC, CTNNB1 and ERBs. Interaction with the SH2 domain of CSK decreases interaction with GSK3B. Interacts with CTNNB1/beta-catenin and JUP/gamma-catenin and promotes cell adhesion. Interaction with JUP/gamma-catenin is induced by heregulin. Binds PRKCD, ERBB2, ERBB3 and ERBB4. Heregulin (HRG) stimulates the interaction with ERBB2 and, to a much lesser extent, the interaction with ERBB3 and ERBB4. Interacts with P53 in response to DNA damage. Interacts with KLF4. Interacts with estrogen receptor alpha/ESR1, through its DNA-binding domain, and stimulates its transcription activity. Binds ADAM17. Isoform ZD forms disulfide-linked oligomers.21 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ABL1P005198EBI-2804728,EBI-375543
CEBPBP176768EBI-10053698,EBI-969696
EGFRP005333EBI-2804728,EBI-297353
METP085812EBI-2804728,EBI-1039152
MUC1P15941-72EBI-2804728,EBI-4396776
U2AF2P263682EBI-2804728,EBI-742339

GO - Molecular functioni

  • p53 binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi110669. 42 interactions.
DIPiDIP-41890N.
IntActiP15941. 9 interactions.
MINTiMINT-156679.
STRINGi9606.ENSP00000357380.

Structurei

Secondary structure

1
1255
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1042 – 105211Combined sources
Helixi1056 – 10594Combined sources
Helixi1064 – 108017Combined sources
Turni1082 – 10854Combined sources
Beta strandi1086 – 109611Combined sources
Beta strandi1099 – 11079Combined sources
Turni1109 – 11113Combined sources
Helixi1114 – 113219Combined sources
Beta strandi1136 – 11427Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1SM3X-ray1.95P919-931[»]
2ACMNMR-A1042-1097[»]
B1098-1152[»]
2FO4X-ray2.70P140-146[»]
ProteinModelPortaliP15941.
SMRiP15941. Positions 1041-1144.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP15941.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati61 – 80201; approximate1 PublicationAdd
BLAST
Repeati81 – 100202; approximate1 PublicationAdd
BLAST
Repeati101 – 1202031 PublicationAdd
BLAST
Repeati121 – 1402041 PublicationAdd
BLAST
Repeati141 – 1602051 PublicationAdd
BLAST
Repeati161 – 1802061 PublicationAdd
BLAST
Repeati181 – 2002071 PublicationAdd
BLAST
Repeati201 – 2202081 PublicationAdd
BLAST
Repeati221 – 2402091 PublicationAdd
BLAST
Repeati241 – 26020101 PublicationAdd
BLAST
Repeati261 – 28020111 PublicationAdd
BLAST
Repeati281 – 30020121 PublicationAdd
BLAST
Repeati301 – 32020131 PublicationAdd
BLAST
Repeati321 – 34020141 PublicationAdd
BLAST
Repeati341 – 36020151 PublicationAdd
BLAST
Repeati361 – 38020161 PublicationAdd
BLAST
Repeati381 – 40020171 PublicationAdd
BLAST
Repeati401 – 42020181 PublicationAdd
BLAST
Repeati421 – 44020191 PublicationAdd
BLAST
Repeati441 – 46020201 PublicationAdd
BLAST
Repeati461 – 48020211 PublicationAdd
BLAST
Repeati481 – 50020221 PublicationAdd
BLAST
Repeati501 – 52020231 PublicationAdd
BLAST
Repeati521 – 54020241 PublicationAdd
BLAST
Repeati541 – 56020251 PublicationAdd
BLAST
Repeati561 – 58020261 PublicationAdd
BLAST
Repeati581 – 60020271 PublicationAdd
BLAST
Repeati601 – 62020281 PublicationAdd
BLAST
Repeati621 – 64020291 PublicationAdd
BLAST
Repeati641 – 66020301 PublicationAdd
BLAST
Repeati661 – 68020311 PublicationAdd
BLAST
Repeati681 – 70020321 PublicationAdd
BLAST
Repeati701 – 72020331 PublicationAdd
BLAST
Repeati721 – 74020341 PublicationAdd
BLAST
Repeati741 – 76020351 PublicationAdd
BLAST
Repeati761 – 78020361 PublicationAdd
BLAST
Repeati781 – 80020371 PublicationAdd
BLAST
Repeati801 – 82020381 PublicationAdd
BLAST
Repeati821 – 84020391 PublicationAdd
BLAST
Repeati841 – 86020401 PublicationAdd
BLAST
Repeati861 – 88020411 PublicationAdd
BLAST
Repeati881 – 90020421 PublicationAdd
BLAST
Repeati901 – 92020431 PublicationAdd
BLAST
Repeati921 – 94020441 PublicationAdd
BLAST
Repeati941 – 96020451 PublicationAdd
BLAST
Repeati961 – 9802046; approximate1 PublicationAdd
BLAST
Repeati981 – 10002047; approximate1 PublicationAdd
BLAST
Repeati1001 – 10202048; approximate1 PublicationAdd
BLAST
Domaini1039 – 1148110SEAPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni126 – 96584042 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-RAdd
BLAST
Regioni1192 – 122837Interaction with P53Add
BLAST
Regioni1223 – 12308Required for interaction with GSK3B
Regioni1233 – 12419Required for interaction with beta- and gamma-catenins

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1203 – 12064Interaction with GRB2
Motifi1229 – 12324Interaction with SRC and ESR1
Motifi1243 – 12464Required for interaction with AP1S2

Sequence similaritiesi

Contains 1 SEA domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IX6R. Eukaryota.
ENOG410ZQ7Z. LUCA.
GeneTreeiENSGT00710000106874.
HOGENOMiHOG000290201.
HOVERGENiHBG003075.
InParanoidiP15941.
KOiK06568.
PhylomeDBiP15941.

Family and domain databases

Gene3Di3.30.70.960. 1 hit.
InterProiIPR023217. Mucin-1.
IPR000082. SEA_dom.
[Graphical view]
PANTHERiPTHR10006:SF8. PTHR10006:SF8. 1 hit.
PfamiPF01390. SEA. 1 hit.
[Graphical view]
SMARTiSM00200. SEA. 1 hit.
[Graphical view]
SUPFAMiSSF82671. SSF82671. 1 hit.
PROSITEiPS50024. SEA. 1 hit.
[Graphical view]

Sequences (17)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 17 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P15941-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTV VTGSGHASST PGGEKETSAT QRSSVPSSTE
60 70 80 90 100
KNAVSMTSSV LSSHSPGSGS STTQGQDVTL APATEPASGS AATWGQDVTS
110 120 130 140 150
VPVTRPALGS TTPPAHDVTS APDNKPAPGS TAPPAHGVTS APDTRPAPGS
160 170 180 190 200
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
210 220 230 240 250
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
260 270 280 290 300
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
310 320 330 340 350
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
360 370 380 390 400
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
410 420 430 440 450
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
460 470 480 490 500
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
510 520 530 540 550
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
560 570 580 590 600
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
610 620 630 640 650
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
660 670 680 690 700
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
710 720 730 740 750
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
760 770 780 790 800
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
810 820 830 840 850
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS
860 870 880 890 900
TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS
910 920 930 940 950
APDTRPAPGS TAPPAHGVTS APDTRPAPGS TAPPAHGVTS APDNRPALGS
960 970 980 990 1000
TAPPVHNVTS ASGSASGSAS TLVHNGTSAR ATTTPASKST PFSIPSHHSD
1010 1020 1030 1040 1050
TPTTLASHST KTDASSTHHS SVPPLTSSNH STSPQLSTGV SFFFLSFHIS
1060 1070 1080 1090 1100
NLQFNSSLED PSTDYYQELQ RDISEMFLQI YKQGGFLGLS NIKFRPGSVV
1110 1120 1130 1140 1150
VQLTLAFREG TINVHDVETQ FNQYKTEAAS RYNLTISDVS VSDVPFPFSA
1160 1170 1180 1190 1200
QSGAGVPGWG IALLVLVCVL VALAIVYLIA LAVCQCRRKN YGQLDIFPAR
1210 1220 1230 1240 1250
DTYHPMSEYP TYHTHGRYVP PSSTDRSPYE KVSAGNGGSS LSYTNPAVAA

TSANL
Length:1,255
Mass (Da):122,102
Last modified:May 18, 2010 - v3
Checksum:i5E28DFC4C20D9A82
GO
Isoform 2 (identifier: P15941-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT

Show »
Length:1,264
Mass (Da):122,941
Checksum:i3810149471D221FD
GO
Isoform 3 (identifier: P15941-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     19-21: Missing.

Show »
Length:1,252
Mass (Da):121,803
Checksum:iA3F30DBFE56DD0C5
GO
Isoform 4 (identifier: P15941-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     20-31: Missing.

Show »
Length:1,243
Mass (Da):121,021
Checksum:iB2C6288C94AABC14
GO
Isoform 5 (identifier: P15941-5) [UniParc]FASTAAdd to basket
Also known as: SEC

The sequence of this isoform differs from the canonical sequence as follows:
     1077-1087: FLQIYKQGGFL → VSIGLSFPMLP
     1088-1255: Missing.

Show »
Length:1,087
Mass (Da):103,836
Checksum:i6039CBB69974EA3E
GO
Isoform 6 (identifier: P15941-6) [UniParc]FASTAAdd to basket
Also known as: X

The sequence of this isoform differs from the canonical sequence as follows:
     54-70: VSMTSSVLSSHSPGSGS → IPAPTTTKSCRETFLKW
     71-1095: Missing.

Show »
Length:230
Mass (Da):24,566
Checksum:i53B036250EC1242D
GO
Isoform Y (identifier: P15941-7) [UniParc]FASTAAdd to basket
Also known as: MUC1/Y

The sequence of this isoform differs from the canonical sequence as follows:
     54-1053: Missing.

Show »
Length:255
Mass (Da):27,566
Checksum:i46DC2580CF357BEF
GO
Isoform 8 (identifier: P15941-8) [UniParc]FASTAAdd to basket
Also known as: Z

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.

Show »
Length:273
Mass (Da):29,592
Checksum:iB72F7F4FC2D23BCC
GO
Isoform 9 (identifier: P15941-9) [UniParc]FASTAAdd to basket
Also known as: S

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.
     1077-1181: Missing.

Show »
Length:168
Mass (Da):18,277
Checksum:i53C6544C2B077B89
GO
Isoform F (identifier: P15941-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     54-87: VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA → IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS
     88-1139: Missing.

Show »
Length:203
Mass (Da):21,556
Checksum:iCC2BE70F8C1B325E
GO
Isoform Y-LSP (identifier: P15941-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.

Note: Lacks the mucin repeats.
Show »
Length:264
Mass (Da):28,405
Checksum:i6E192550756A6D4A
GO
Isoform S2 (identifier: P15941-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.
     1077-1181: Missing.

Show »
Length:159
Mass (Da):17,090
Checksum:i2C3B69F515D73168
GO
Isoform M6 (identifier: P15941-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     54-1035: Missing.
     1141-1180: VSDVPFPFSA...VALAIVYLIA → GCLSVPPKEL...LPHPWALCAP
     1181-1255: Missing.

Show »
Length:198
Mass (Da):21,663
Checksum:i5300166458B017CB
GO
Isoform ZD (identifier: P15941-14) [UniParc]FASTAAdd to basket
Also known as: J19

The sequence of this isoform differs from the canonical sequence as follows:
     54-96: VSMTSSVLSS...ASGSAATWGQ → IPAPTTTKSC...SSGQDLWWYN
     97-1255: Missing.

Note: Lacks the mucin repeats. Exists as a disulfide-linked oligomer.
Show »
Length:96
Mass (Da):10,403
Checksum:iF2140812C4C11983
GO
Isoform T10 (identifier: P15941-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1093: Missing.

Show »
Length:224
Mass (Da):23,747
Checksum:i977E7703C14AC936
GO
Isoform E2 (identifier: P15941-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1151: Missing.

Show »
Length:166
Mass (Da):17,287
Checksum:iBF6C969984986AD0
GO
Isoform J13 (identifier: P15941-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-19: T → TATTAPKPAT
     54-1053: Missing.
     1232-1255: VSAGNGGSSLSYTNPAVAATSANL → RQNGWSTMPRGALPEESQG

Show »
Length:259
Mass (Da):28,297
Checksum:iFD53C9223E24B094
GO

Sequence cautioni

The sequence AAD14369 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAD14376 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21T → A in AAD14369 (PubMed:8604237).Curated
Sequence conflicti134 – 1341P → Q in AAA35757 (PubMed:2597151).Curated
Sequence conflicti154 – 1541P → Q in AAA35757 (PubMed:2597151).Curated
Sequence conflicti1021 – 10211S → T in AAA35805 (PubMed:2318825).Curated
Sequence conflicti1021 – 10211S → T in AAA35807 (PubMed:2318825).Curated
Sequence conflicti1021 – 10211S → T in AAA59876 (PubMed:1697589).Curated
Sequence conflicti1143 – 11431D → G in AAP97018 (PubMed:22941036).Curated
Sequence conflicti1193 – 11931Q → L in AAK30142 (PubMed:15969018).Curated
Sequence conflicti1231 – 12311K → T in AAD10858 (PubMed:9212228).Curated
Sequence conflicti1251 – 12511T → A in AAA60019 (PubMed:2394722).Curated

Polymorphismi

The number of repeats is highly polymorphic. It varies from 21 to 125 in the northern European population. The most frequent alleles contains 41 and 85 repeats. The tandemly repeated icosapeptide underlies polymorphism at three positions: PAPGSTAP[PAQT]AHGVTSAP[DT/ES]R, DT -> ES and the single replacements P -> A, P -> Q and P-> T. The most frequent replacement DT -> ES occurs in up to 50% of the repeats.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1117 – 11171V → M.3 Publications
Corresponds to variant rs1611770 [ dbSNP | Ensembl ].
VAR_019390
Natural varianti1142 – 11421S → N.1 Publication
Corresponds to variant rs11465207 [ dbSNP | Ensembl ].
VAR_019391

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei19 – 213Missing in isoform 3. 1 PublicationVSP_003281
Alternative sequencei19 – 191T → TATTAPKPAT in isoform 2, isoform Y-LSP, isoform E2, isoform J13, isoform S2 and isoform T10. 6 PublicationsVSP_003280
Alternative sequencei20 – 3112Missing in isoform 4. 1 PublicationVSP_003282Add
BLAST
Alternative sequencei54 – 11511098Missing in isoform E2. 1 PublicationVSP_047872Add
BLAST
Alternative sequencei54 – 10931040Missing in isoform T10. 1 PublicationVSP_047873Add
BLAST
Alternative sequencei54 – 10531000Missing in isoform J13, isoform Y, isoform Y-LSP and isoform S2. 6 PublicationsVSP_003285Add
BLAST
Alternative sequencei54 – 1035982Missing in isoform 8, isoform 9 and isoform M6. 4 PublicationsVSP_003286Add
BLAST
Alternative sequencei54 – 9643VSMTS…ATWGQ → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILSSGQDLW WYN in isoform ZD. 2 PublicationsVSP_047575Add
BLAST
Alternative sequencei54 – 8734VSMTS…ATEPA → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILS in isoform F. 1 PublicationVSP_035046Add
BLAST
Alternative sequencei54 – 7017VSMTS…PGSGS → IPAPTTTKSCRETFLKW in isoform 6. 2 PublicationsVSP_003283Add
BLAST
Alternative sequencei71 – 10951025Missing in isoform 6. 2 PublicationsVSP_003284Add
BLAST
Alternative sequencei88 – 11391052Missing in isoform F. 1 PublicationVSP_035047Add
BLAST
Alternative sequencei97 – 12551159Missing in isoform ZD. 2 PublicationsVSP_047576Add
BLAST
Alternative sequencei1077 – 1181105Missing in isoform 9 and isoform S2. 3 PublicationsVSP_003287Add
BLAST
Alternative sequencei1077 – 108711FLQIYKQGGFL → VSIGLSFPMLP in isoform 5. 1 PublicationVSP_003288Add
BLAST
Alternative sequencei1088 – 1255168Missing in isoform 5. 1 PublicationVSP_003289Add
BLAST
Alternative sequencei1141 – 118040VSDVP…VYLIA → GCLSVPPKELRAAGHLSSPG YLPSYERVPHLPHPWALCAP in isoform M6. 2 PublicationsVSP_046962Add
BLAST
Alternative sequencei1181 – 125575Missing in isoform M6. 2 PublicationsVSP_046963Add
BLAST
Alternative sequencei1232 – 125524VSAGN…TSANL → RQNGWSTMPRGALPEESQG in isoform J13. 1 PublicationVSP_047874Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J05582 mRNA. Translation: AAA60019.1.
M32738 mRNA. Translation: AAA35804.1.
M32739 mRNA. Translation: AAA35806.1.
M34089 mRNA. Translation: AAA35807.1.
M34088 mRNA. Translation: AAA35805.1.
J05581 mRNA. Translation: AAA59876.1.
M61170 Genomic DNA. Translation: AAB53150.1.
X52229 mRNA. Translation: CAA36478.1. Sequence problems.
X52228 mRNA. Translation: CAA36477.1. Sequence problems.
M35093 Genomic DNA. Translation: AAB59612.1. Sequence problems.
X80761 mRNA. Translation: CAA56734.1.
U60259 mRNA. Translation: AAD10856.1.
U60260 mRNA. Translation: AAD10857.1.
U60261 mRNA. Translation: AAD10858.1.
AF125525 mRNA. Translation: AAD27842.1.
AY466157 mRNA. Translation: AAR28764.1.
AY327582 mRNA. Translation: AAP97013.1.
AY327584 mRNA. Translation: AAP97015.1.
AY327586 mRNA. Translation: AAP97017.1.
AY327587 mRNA. Translation: AAP97018.1.
EF583653 mRNA. Translation: ABQ59628.1.
EF670711 mRNA. Translation: ABS01298.1.
EF670712 mRNA. Translation: ABS01299.1.
FJ226040 mRNA. Translation: ACI25172.1.
FJ226047 mRNA. Translation: ACI25179.1.
AF348143 mRNA. Translation: AAK30142.1.
AY463543 Genomic DNA. Translation: AAR18816.1.
AL713999 Genomic DNA. Translation: CAI95071.1.
AL713999 Genomic DNA. Translation: CAI95073.1.
AL713999 Genomic DNA. Translation: CAI95074.1.
AL713999 Genomic DNA. Translation: CAI95080.1.
CH471121 Genomic DNA. Translation: EAW53116.1.
CH471121 Genomic DNA. Translation: EAW53117.1.
CH471121 Genomic DNA. Translation: EAW53118.1.
CH471121 Genomic DNA. Translation: EAW53119.1.
BC120974 mRNA. Translation: AAI20975.1.
BC120975 mRNA. Translation: AAI20976.1.
Z17324 mRNA. Translation: CAA78972.1.
Z17325 mRNA. Translation: CAA78973.1.
M31823 mRNA. Translation: AAA35757.1.
S81781 mRNA. Translation: AAD14376.1. Different initiation.
S81736 mRNA. Translation: AAD14369.1. Different initiation.
M21868 mRNA. Translation: AAA59874.1. Sequence problems.
CCDSiCCDS1098.1. [P15941-8]
CCDS30882.1. [P15941-11]
CCDS30883.1. [P15941-7]
CCDS41408.1. [P15941-12]
CCDS41409.1. [P15941-10]
CCDS55641.1. [P15941-6]
CCDS55642.1. [P15941-13]
PIRiA35175.
RefSeqiNP_001018016.1. NM_001018016.2. [P15941-11]
NP_001018017.1. NM_001018017.2. [P15941-7]
NP_001037855.1. NM_001044390.2. [P15941-10]
NP_001037856.1. NM_001044391.2.
NP_001037857.1. NM_001044392.2. [P15941-12]
NP_001037858.1. NM_001044393.2.
NP_001191214.1. NM_001204285.1.
NP_001191215.1. NM_001204286.1.
NP_001191216.1. NM_001204287.1.
NP_001191217.1. NM_001204288.1.
NP_001191218.1. NM_001204289.1.
NP_001191219.1. NM_001204290.1.
NP_001191220.1. NM_001204291.1.
NP_001191221.1. NM_001204292.1.
NP_001191222.1. NM_001204293.1. [P15941-13]
NP_001191223.1. NM_001204294.1. [P15941-6]
NP_001191224.1. NM_001204295.1.
NP_001191225.1. NM_001204296.1.
NP_001191226.1. NM_001204297.1.
NP_002447.4. NM_002456.5. [P15941-8]
UniGeneiHs.89603.

Genome annotation databases

EnsembliENST00000337604; ENSP00000338983; ENSG00000185499. [P15941-8]
ENST00000342482; ENSP00000342814; ENSG00000185499. [P15941-16]
ENST00000343256; ENSP00000339690; ENSG00000185499. [P15941-10]
ENST00000368389; ENSP00000357374; ENSG00000185499. [P15941-9]
ENST00000368390; ENSP00000357375; ENSG00000185499. [P15941-7]
ENST00000368392; ENSP00000357377; ENSG00000185499. [P15941-11]
ENST00000368393; ENSP00000357378; ENSG00000185499. [P15941-13]
ENST00000368396; ENSP00000357381; ENSG00000185499. [P15941-12]
ENST00000368398; ENSP00000357383; ENSG00000185499. [P15941-6]
GeneIDi4582.
KEGGihsa:4582.
UCSCiuc001fia.4. human. [P15941-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Mucin database
NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
J05582 mRNA. Translation: AAA60019.1.
M32738 mRNA. Translation: AAA35804.1.
M32739 mRNA. Translation: AAA35806.1.
M34089 mRNA. Translation: AAA35807.1.
M34088 mRNA. Translation: AAA35805.1.
J05581 mRNA. Translation: AAA59876.1.
M61170 Genomic DNA. Translation: AAB53150.1.
X52229 mRNA. Translation: CAA36478.1. Sequence problems.
X52228 mRNA. Translation: CAA36477.1. Sequence problems.
M35093 Genomic DNA. Translation: AAB59612.1. Sequence problems.
X80761 mRNA. Translation: CAA56734.1.
U60259 mRNA. Translation: AAD10856.1.
U60260 mRNA. Translation: AAD10857.1.
U60261 mRNA. Translation: AAD10858.1.
AF125525 mRNA. Translation: AAD27842.1.
AY466157 mRNA. Translation: AAR28764.1.
AY327582 mRNA. Translation: AAP97013.1.
AY327584 mRNA. Translation: AAP97015.1.
AY327586 mRNA. Translation: AAP97017.1.
AY327587 mRNA. Translation: AAP97018.1.
EF583653 mRNA. Translation: ABQ59628.1.
EF670711 mRNA. Translation: ABS01298.1.
EF670712 mRNA. Translation: ABS01299.1.
FJ226040 mRNA. Translation: ACI25172.1.
FJ226047 mRNA. Translation: ACI25179.1.
AF348143 mRNA. Translation: AAK30142.1.
AY463543 Genomic DNA. Translation: AAR18816.1.
AL713999 Genomic DNA. Translation: CAI95071.1.
AL713999 Genomic DNA. Translation: CAI95073.1.
AL713999 Genomic DNA. Translation: CAI95074.1.
AL713999 Genomic DNA. Translation: CAI95080.1.
CH471121 Genomic DNA. Translation: EAW53116.1.
CH471121 Genomic DNA. Translation: EAW53117.1.
CH471121 Genomic DNA. Translation: EAW53118.1.
CH471121 Genomic DNA. Translation: EAW53119.1.
BC120974 mRNA. Translation: AAI20975.1.
BC120975 mRNA. Translation: AAI20976.1.
Z17324 mRNA. Translation: CAA78972.1.
Z17325 mRNA. Translation: CAA78973.1.
M31823 mRNA. Translation: AAA35757.1.
S81781 mRNA. Translation: AAD14376.1. Different initiation.
S81736 mRNA. Translation: AAD14369.1. Different initiation.
M21868 mRNA. Translation: AAA59874.1. Sequence problems.
CCDSiCCDS1098.1. [P15941-8]
CCDS30882.1. [P15941-11]
CCDS30883.1. [P15941-7]
CCDS41408.1. [P15941-12]
CCDS41409.1. [P15941-10]
CCDS55641.1. [P15941-6]
CCDS55642.1. [P15941-13]
PIRiA35175.
RefSeqiNP_001018016.1. NM_001018016.2. [P15941-11]
NP_001018017.1. NM_001018017.2. [P15941-7]
NP_001037855.1. NM_001044390.2. [P15941-10]
NP_001037856.1. NM_001044391.2.
NP_001037857.1. NM_001044392.2. [P15941-12]
NP_001037858.1. NM_001044393.2.
NP_001191214.1. NM_001204285.1.
NP_001191215.1. NM_001204286.1.
NP_001191216.1. NM_001204287.1.
NP_001191217.1. NM_001204288.1.
NP_001191218.1. NM_001204289.1.
NP_001191219.1. NM_001204290.1.
NP_001191220.1. NM_001204291.1.
NP_001191221.1. NM_001204292.1.
NP_001191222.1. NM_001204293.1. [P15941-13]
NP_001191223.1. NM_001204294.1. [P15941-6]
NP_001191224.1. NM_001204295.1.
NP_001191225.1. NM_001204296.1.
NP_001191226.1. NM_001204297.1.
NP_002447.4. NM_002456.5. [P15941-8]
UniGeneiHs.89603.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1SM3X-ray1.95P919-931[»]
2ACMNMR-A1042-1097[»]
B1098-1152[»]
2FO4X-ray2.70P140-146[»]
ProteinModelPortaliP15941.
SMRiP15941. Positions 1041-1144.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110669. 42 interactions.
DIPiDIP-41890N.
IntActiP15941. 9 interactions.
MINTiMINT-156679.
STRINGi9606.ENSP00000357380.

Protein family/group databases

MEROPSiS71.001.

PTM databases

iPTMnetiP15941.
PhosphoSiteiP15941.
SwissPalmiP15941.
UniCarbKBiP15941.

Polymorphism and mutation databases

BioMutaiMUC1.
DMDMi296439295.

Proteomic databases

MaxQBiP15941.
PaxDbiP15941.
PeptideAtlasiP15941.
PRIDEiP15941.

Protocols and materials databases

DNASUi4582.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337604; ENSP00000338983; ENSG00000185499. [P15941-8]
ENST00000342482; ENSP00000342814; ENSG00000185499. [P15941-16]
ENST00000343256; ENSP00000339690; ENSG00000185499. [P15941-10]
ENST00000368389; ENSP00000357374; ENSG00000185499. [P15941-9]
ENST00000368390; ENSP00000357375; ENSG00000185499. [P15941-7]
ENST00000368392; ENSP00000357377; ENSG00000185499. [P15941-11]
ENST00000368393; ENSP00000357378; ENSG00000185499. [P15941-13]
ENST00000368396; ENSP00000357381; ENSG00000185499. [P15941-12]
ENST00000368398; ENSP00000357383; ENSG00000185499. [P15941-6]
GeneIDi4582.
KEGGihsa:4582.
UCSCiuc001fia.4. human. [P15941-1]

Organism-specific databases

CTDi4582.
GeneCardsiMUC1.
GeneReviewsiMUC1.
HGNCiHGNC:7508. MUC1.
HPAiCAB000036.
CAB001986.
HPA004179.
HPA007235.
HPA008855.
MalaCardsiMUC1.
MIMi113720. gene.
158340. gene.
174000. phenotype.
neXtProtiNX_P15941.
Orphaneti34149. Autosomal dominant medullary cystic kidney disease with or without hyperuricemia.
PharmGKBiPA31309.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IX6R. Eukaryota.
ENOG410ZQ7Z. LUCA.
GeneTreeiENSGT00710000106874.
HOGENOMiHOG000290201.
HOVERGENiHBG003075.
InParanoidiP15941.
KOiK06568.
PhylomeDBiP15941.

Enzyme and pathway databases

ReactomeiR-HSA-5083625. Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC).
R-HSA-5083632. Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS).
R-HSA-5083636. Defective GALNT12 causes colorectal cancer 1 (CRCS1).
R-HSA-913709. O-linked glycosylation of mucins.
R-HSA-977068. Termination of O-glycan biosynthesis.
SIGNORiP15941.

Miscellaneous databases

ChiTaRSiMUC1. human.
EvolutionaryTraceiP15941.
GeneWikiiMUC1.
GenomeRNAii4582.
PROiP15941.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185499.
ExpressionAtlasiP15941. baseline and differential.
GenevisibleiP15941. HS.

Family and domain databases

Gene3Di3.30.70.960. 1 hit.
InterProiIPR023217. Mucin-1.
IPR000082. SEA_dom.
[Graphical view]
PANTHERiPTHR10006:SF8. PTHR10006:SF8. 1 hit.
PfamiPF01390. SEA. 1 hit.
[Graphical view]
SMARTiSM00200. SEA. 1 hit.
[Graphical view]
SUPFAMiSSF82671. SSF82671. 1 hit.
PROSITEiPS50024. SEA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMUC1_HUMAN
AccessioniPrimary (citable) accession number: P15941
Secondary accession number(s): A5YRV1
, A6ZID9, A6ZIE0, B1AVQ8, B1AVR0, B6ECA1, E7ESE5, E7EUG9, P13931, P15942, P17626, Q0VAP5, Q0VAP6, Q14128, Q14876, Q16437, Q16442, Q16615, Q6S4Y3, Q7Z547, Q7Z548, Q7Z550, Q7Z552, Q9BXA4, Q9UE75, Q9UE76, Q9UQL1, Q9Y4J2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: May 18, 2010
Last modified: September 7, 2016
This is version 188 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The name KL-6 was originally that of a murine monoclonal antibody reacting with pulmonary adenocarcinoma cell lines and pulmonary epithelial cells. This antibody recognizes a sialylated carbohydrate chain on MUC1.

Caution

O-glycosylation sites are annotated in first sequence repeat only. Residues at similar position are probably glycosylated in all repeats. Experimental sites were determined in a synthetic peptide glycosylated in vitro (PubMed:7744025, PubMed:9597769).2 Publications

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.