P15941 (MUC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 151.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mucin-1 Short name=MUC-1 Alternative name(s): Breast carcinoma-associated antigen DF3 Cancer antigen 15-3 Short name=CA 15-3 Carcinoma-associated mucin Episialin H23AG Krebs von den Lungen-6 Short name=KL-6 PEMT Peanut-reactive urinary mucin Short name=PUM Polymorphic epithelial mucin Short name=PEM Tumor-associated epithelial membrane antigen Short name=EMA Tumor-associated mucin CD_antigen=CD227 Cleaved into the following 2 chains:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1255 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack. Ref.28 Ref.39 Ref.42 Ref.47 Ref.48 Ref.51 Ref.54 Ref.55 Ref.57 The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity. Ref.28 Ref.39 Ref.42 Ref.47 Ref.48 Ref.51 Ref.54 Ref.55 Ref.57 |
| Subunit structure | The alpha subunit forms a tight, non-covalent heterodimeric complex with the proteolytically-released beta-subunit. Interaction, via the tandem repeat region, with domain 1 of ICAM1 is implicated in cell migration and metastases. Isoform 1 binds directly the SH2 domain of GRB2, and forms a MUC1/GRB2/SOS1 complex involved in RAS signaling. The cytoplasmic tail (MUC1CT) interacts with several proteins such as SRC, CTNNB1 and ERBs. Interaction with the SH2 domain of CSK decreases interaction with GSK3B. Interacts with CTNNB1/beta-catenin and JUP/gamma-catenin and promotes cell adhesion. Interaction with JUP/gamma-catenin is induced by heregulin. Binds PRKCD, ERBB2, ERBB3 and ERBB4. Heregulin (HRG) stimulates the interaction with ERBB2 and, to a much lesser extent, the interaction with ERBB3 and ERBB4. Interacts with P53 in response to DNA damage. Interacts with KLF4. Interacts with estrogen receptor alpha/ESR1, through its DNA-binding domain, and stimulates its transcription activity. Binds ADAM17. Ref.26 Ref.28 Ref.32 Ref.34 Ref.36 Ref.38 Ref.39 Ref.41 Ref.42 Ref.43 Ref.44 Ref.45 Ref.46 Ref.47 Ref.48 Ref.51 Ref.52 Ref.53 Ref.54 Ref.55 Ref.57 |
| Subcellular location | Apical cell membrane; Single-pass type I membrane protein. Note: Exclusively located in the apical domain of the plasma membrane of highly polarized epithelial cells. After endocytosis, internalized and recycled to the cell membrane. Located to microvilli and to the tips of long filopodial protusions. Ref.35 Ref.44 Ref.45 Ref.46 Ref.50 Ref.52 Ref.54 Ref.56 Isoform 5: Secreted Ref.35 Ref.44 Ref.45 Ref.46 Ref.50 Ref.52 Ref.54 Ref.56. Isoform 7: Secreted Ref.35 Ref.44 Ref.45 Ref.46 Ref.50 Ref.52 Ref.54 Ref.56. Isoform 9: Secreted Ref.35 Ref.44 Ref.45 Ref.46 Ref.50 Ref.52 Ref.54 Ref.56. Mucin-1 subunit beta: Cell membrane. Cytoplasm. Nucleus. Note: On EGF and PDGFRB stimulation, transported to the nucleus through interaction with CTNNB1, a process which is stimulated by phosphorylation. On HRG stimulation, colocalizes with JUP/gamma-catenin at the nucleus. Ref.35 Ref.44 Ref.45 Ref.46 Ref.50 Ref.52 Ref.54 Ref.56 |
| Tissue specificity | Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform 7 is expressed in tumor cells only. Ref.9 Ref.51 |
| Developmental stage | During fetal development, expressed at low levels in the colonic epithelium from 13 weeks of gestation. Ref.30 |
| Post-translational modification | Highly glycosylated (N- and O-linked carbohydrates and sialic acid). O-glycosylated to a varying degree on serine and threonine residues within each tandem repeat, ranging from mono- to penta-glycosylation. The average density ranges from about 50% in human milk to over 90% in T47D breast cancer cells. Further sialylation occurs during recycling. Membrane-shed glycoproteins from kidney and breast cancer cells have preferentially sialyated core 1 structures, while secreted forms from the same tissues display mainly core 2 structures. The O-glycosylated content is overlapping in both these tissues with terminal fucose and galactose, 2- and 3-linked galactose, 3- and 3,6-linked GalNAc-ol and 4-linked GlcNAc predominating. Differentially O-glycosylated in breast carcinomas with 3,4-linked GlcNAc. N-glycosylation consists of high-mannose, acidic complex-type and hybrid glycans in the secreted form MUC1/SEC, and neutral complex-type in the transmembrane form, MUC1/TM. Ref.24 Ref.27 Ref.29 Ref.31 Ref.50 Ref.59 Proteolytic cleavage in the SEA domain occurs in the endoplasmic reticulum by an autoproteolytic mechanism and requires the full-length SEA domain as well as requiring a Ser, Thr or Cys residue at the P + 1 site. Cleavage at this site also occurs on isoform MUC1/X but not on isoform MUC1/Y. Ectodomain shedding is mediated by ADAM17. Dual palmitoylation on cysteine residues in the CQC motif is required for recycling from endosomes back to the plasma membrane. Ref.52 Phosphorylated on tyrosines and serine residues in the C-terminal. Phosphorylation on tyrosines in the C-terminal increases the nuclear location of MUC1 and beta-catenin. Phosphorylation by PKC delta induces binding of MUC1 to beta-catenin/CTNNB1 and thus decreases the formation of the beta-catenin/E-cadherin complex. Src-mediated phosphorylation inhibits interaction with GSK3B. Src- and EGFR-mediated phosphorylation on Tyr-1229 increases binding to beta-catenin/CTNNB1. GSK3B-mediated phosphorylation on Ser-1227 decreases this interaction but restores the formation of the beta-cadherin/E-cadherin complex. On T-cell receptor activation, phosphorylated by LCK. PDGFR-mediated phosphorylation increases nuclear colocalization of MUC1CT and CTNNB1. Ref.25 Ref.26 Ref.32 Ref.36 Ref.38 Ref.39 Ref.40 Ref.41 Ref.48 Ref.51 Ref.56 The N-terminal sequence has been shown to begin at position 24 or 28 (Ref.22). |
| Polymorphism | The number of repeats is highly polymorphic. It varies from 21 to 125 in the northern European population. The most frequent alleles contains 41 and 85 repeats. The tandemly repeated icosapeptide underlies polymorphism at three positions: PAPGSTAP[PAQT]AHGVTSAP[DT/ES]R, DT -> ES and the single replacements P -> A, P -> Q and P-> T. The most frequent replacement DT -> ES occurs in up to 50% of the repeats. |
| Involvement in disease | MUC1/CA 15-3 is used as a serological clinical marker of breast cancer to monitor response to breast cancer treatment and disease recurrence (Ref.58). Decreased levels over time may be indicative of a positive response to treatment. Conversely, increased levels may indicate disease progression. At an early stage disease, only 21% of patients exhibit high MUC1/CA 15-3 levels, that is why CA 15-3 is not a useful screening test. Most antibodies target the highly immunodominant core peptide domain of 20 amino acid (APDTRPAPGSTAPPAHGVTS) tandem repeats. Some antibodies recognize glycosylated epitopes. |
| Miscellaneous | The name KL-6 was originally that of a murine monoclonal antibody reacting with pulmonary adenocarcinoma cell lines and pulmonary epithelial cells. This antibody recognizes a sialylated carbohydrate chain on MUC1. |
| Sequence similarities | Contains 1 SEA domain. |
| Caution | O-glycosylation sites are annotated in first sequence repeat only. Residues at similar position are probably glycosylated in all repeats. Experimental sites were determined in a synthetic peptide glycosylated in vitro (Ref.27, Ref.31). |
| Sequence caution | The sequence AAD14369.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAD14376.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MUC1 | P15941-7 | 2 | EBI-2804728,EBI-4396776 |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P15941-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P15941-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 19-19: T → TATTAPKPAT | ||||||
| Isoform 3 (identifier: P15941-3) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 19-21: Missing. | ||||||
| Isoform 4 (identifier: P15941-4) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 20-31: Missing. | ||||||
| Isoform 5 (identifier: P15941-5) Also known as: SEC; The sequence of this isoform differs from the canonical sequence as follows: 1077-1087: FLQIYKQGGFL → VSIGLSFPMLP 1088-1255: Missing. | ||||||
| Isoform 6 (identifier: P15941-6) Also known as: X; The sequence of this isoform differs from the canonical sequence as follows: 54-70: VSMTSSVLSSHSPGSGS → IPAPTTTKSCRETFLKW 71-1095: Missing. | ||||||
| Isoform 7 (identifier: P15941-7) Also known as: Y; The sequence of this isoform differs from the canonical sequence as follows: 54-1053: Missing. | ||||||
| Isoform 8 (identifier: P15941-8) Also known as: Z; The sequence of this isoform differs from the canonical sequence as follows: 54-1035: Missing. | ||||||
| Isoform 9 (identifier: P15941-9) Also known as: S; The sequence of this isoform differs from the canonical sequence as follows: 54-1035: Missing. 1077-1181: Missing. | ||||||
| Isoform 10 (identifier: P15941-10) Also known as: F; The sequence of this isoform differs from the canonical sequence as follows: 54-87: VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA → IPAPTTTKSCRETFLKCFCRFINKGVFWASPILS 88-1139: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Ref.22 | |||||||||||||||||||||||
| Chain | 24 – 1255 | 1232 | Mucin-1 | PRO_0000019277 | ||||||||||||||||||||||
| Chain | 24 – 1097 | 1074 | Mucin-1 subunit alpha | PRO_0000317446 | ||||||||||||||||||||||
| Chain | 1098 – 1255 | 158 | Mucin-1 subunit beta | PRO_0000317447 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Topological domain | 24 – 1158 | 1135 | Extracellular Potential | |||||||||||||||||||||||
| Transmembrane | 1159 – 1181 | 23 | Helical; Potential | |||||||||||||||||||||||
| Topological domain | 1182 – 1255 | 74 | Cytoplasmic Potential | |||||||||||||||||||||||
| Repeat | 61 – 80 | 20 | 1; approximate | |||||||||||||||||||||||
| Repeat | 81 – 100 | 20 | 2; approximate | |||||||||||||||||||||||
| Repeat | 101 – 120 | 20 | 3 | |||||||||||||||||||||||
| Repeat | 121 – 140 | 20 | 4 | |||||||||||||||||||||||
| Repeat | 141 – 160 | 20 | 5 | |||||||||||||||||||||||
| Repeat | 161 – 180 | 20 | 6 | |||||||||||||||||||||||
| Repeat | 181 – 200 | 20 | 7 | |||||||||||||||||||||||
| Repeat | 201 – 220 | 20 | 8 | |||||||||||||||||||||||
| Repeat | 221 – 240 | 20 | 9 | |||||||||||||||||||||||
| Repeat | 241 – 260 | 20 | 10 | |||||||||||||||||||||||
| Repeat | 261 – 280 | 20 | 11 | |||||||||||||||||||||||
| Repeat | 281 – 300 | 20 | 12 | |||||||||||||||||||||||
| Repeat | 301 – 320 | 20 | 13 | |||||||||||||||||||||||
| Repeat | 321 – 340 | 20 | 14 | |||||||||||||||||||||||
| Repeat | 341 – 360 | 20 | 15 | |||||||||||||||||||||||
| Repeat | 361 – 380 | 20 | 16 | |||||||||||||||||||||||
| Repeat | 381 – 400 | 20 | 17 | |||||||||||||||||||||||
| Repeat | 401 – 420 | 20 | 18 | |||||||||||||||||||||||
| Repeat | 421 – 440 | 20 | 19 | |||||||||||||||||||||||
| Repeat | 441 – 460 | 20 | 20 | |||||||||||||||||||||||
| Repeat | 461 – 480 | 20 | 21 | |||||||||||||||||||||||
| Repeat | 481 – 500 | 20 | 22 | |||||||||||||||||||||||
| Repeat | 501 – 520 | 20 | 23 | |||||||||||||||||||||||
| Repeat | 521 – 540 | 20 | 24 | |||||||||||||||||||||||
| Repeat | 541 – 560 | 20 | 25 | |||||||||||||||||||||||
| Repeat | 561 – 580 | 20 | 26 | |||||||||||||||||||||||
| Repeat | 581 – 600 | 20 | 27 | |||||||||||||||||||||||
| Repeat | 601 – 620 | 20 | 28 | |||||||||||||||||||||||
| Repeat | 621 – 640 | 20 | 29 | |||||||||||||||||||||||
| Repeat | 641 – 660 | 20 | 30 | |||||||||||||||||||||||
| Repeat | 661 – 680 | 20 | 31 | |||||||||||||||||||||||
| Repeat | 681 – 700 | 20 | 32 | |||||||||||||||||||||||
| Repeat | 701 – 720 | 20 | 33 | |||||||||||||||||||||||
| Repeat | 721 – 740 | 20 | 34 | |||||||||||||||||||||||
| Repeat | 741 – 760 | 20 | 35 | |||||||||||||||||||||||
| Repeat | 761 – 780 | 20 | 36 | |||||||||||||||||||||||
| Repeat | 781 – 800 | 20 | 37 | |||||||||||||||||||||||
| Repeat | 801 – 820 | 20 | 38 | |||||||||||||||||||||||
| Repeat | 821 – 840 | 20 | 39 | |||||||||||||||||||||||
| Repeat | 841 – 860 | 20 | 40 | |||||||||||||||||||||||
| Repeat | 861 – 880 | 20 | 41 | |||||||||||||||||||||||
| Repeat | 881 – 900 | 20 | 42 | |||||||||||||||||||||||
| Repeat | 901 – 920 | 20 | 43 | |||||||||||||||||||||||
| Repeat | 921 – 940 | 20 | 44 | |||||||||||||||||||||||
| Repeat | 941 – 960 | 20 | 45 | |||||||||||||||||||||||
| Repeat | 961 – 980 | 20 | 46; approximate | |||||||||||||||||||||||
| Repeat | 981 – 1000 | 20 | 47; approximate | |||||||||||||||||||||||
| Repeat | 1001 – 1020 | 20 | 48; approximate | |||||||||||||||||||||||
| Domain | 1034 – 1151 | 118 | SEA | |||||||||||||||||||||||
| Region | 126 – 965 | 840 | 42 X 20 AA approximate tandem repeats of P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R | |||||||||||||||||||||||
| Region | 1192 – 1228 | 37 | Interaction with P53 | |||||||||||||||||||||||
| Region | 1223 – 1230 | 8 | Required for interaction with GSK3B | |||||||||||||||||||||||
| Region | 1233 – 1241 | 9 | Required for interaction with beta- and gamma-catenins | |||||||||||||||||||||||
| Motif | 1203 – 1206 | 4 | Interaction with GRB2 | |||||||||||||||||||||||
| Motif | 1229 – 1232 | 4 | Interaction with SRC and ESR1 | |||||||||||||||||||||||
| Motif | 1243 – 1246 | 4 | Required for interaction with AP1S2 | |||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||
| Site | 1097 – 1098 | 2 | Cleavage; by autolysis | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 1191 | 1 | Phosphotyrosine | |||||||||||||||||||||||
| Modified residue | 1203 | 1 | Phosphotyrosine; by PDGFR Ref.40 Ref.56 | |||||||||||||||||||||||
| Modified residue | 1209 | 1 | Phosphotyrosine | |||||||||||||||||||||||
| Modified residue | 1212 | 1 | Phosphotyrosine Ref.40 | |||||||||||||||||||||||
| Modified residue | 1218 | 1 | Phosphotyrosine; by PDGFR Ref.56 | |||||||||||||||||||||||
| Modified residue | 1224 | 1 | Phosphothreonine; by PKC/PRKCD Ref.39 | |||||||||||||||||||||||
| Modified residue | 1227 | 1 | Phosphoserine; by GSK3-beta Ref.32 | |||||||||||||||||||||||
| Modified residue | 1229 | 1 | Phosphotyrosine; by CSK, EGFR and SRC Ref.36 Ref.38 Ref.40 Ref.56 | |||||||||||||||||||||||
| Modified residue | 1243 | 1 | Phosphotyrosine Ref.40 | |||||||||||||||||||||||
| Lipidation | 1184 | 1 | S-palmitoyl cysteine Ref.52 | |||||||||||||||||||||||
| Lipidation | 1186 | 1 | S-palmitoyl cysteine Ref.52 | |||||||||||||||||||||||
| Glycosylation | 131 | 1 | O-linked (GalNAc...) Probable | |||||||||||||||||||||||
| Glycosylation | 139 | 1 | O-linked (GalNAc...) Probable | |||||||||||||||||||||||
| Glycosylation | 140 | 1 | O-linked (GalNAc...) Potential | |||||||||||||||||||||||
| Glycosylation | 144 | 1 | O-linked (GalNAc...) Potential | |||||||||||||||||||||||
| Glycosylation | 957 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||
| Glycosylation | 975 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||
| Glycosylation | 1029 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||
| Glycosylation | 1055 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||
| Glycosylation | 1133 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 19 – 21 | 3 | Missing in isoform 3. | VSP_003281 | ||||||||||||||||||||||
| Alternative sequence | 19 | 1 | T → TATTAPKPAT in isoform 2. | VSP_003280 | ||||||||||||||||||||||
| Alternative sequence | 20 – 31 | 12 | Missing in isoform 4. | VSP_003282 | ||||||||||||||||||||||
| Alternative sequence | 54 – 1053 | 1000 | Missing in isoform 7. | VSP_003285 | ||||||||||||||||||||||
| Alternative sequence | 54 – 1035 | 982 | Missing in isoform 8 and isoform 9. | VSP_003286 | ||||||||||||||||||||||
| Alternative sequence | 54 – 87 | 34 | VSMTS…ATEPA → IPAPTTTKSCRETFLKCFCR FINKGVFWASPILS in isoform 10. | VSP_035046 | ||||||||||||||||||||||
| Alternative sequence | 54 – 70 | 17 | VSMTS…PGSGS → IPAPTTTKSCRETFLKW in isoform 6. | VSP_003283 | ||||||||||||||||||||||
| Alternative sequence | 71 – 1095 | 1025 | Missing in isoform 6. | VSP_003284 | ||||||||||||||||||||||
| Alternative sequence | 88 – 1139 | 1052 | Missing in isoform 10. | VSP_035047 | ||||||||||||||||||||||
| Alternative sequence | 1077 – 1181 | 105 | Missing in isoform 9. | VSP_003287 | ||||||||||||||||||||||
| Alternative sequence | 1077 – 1087 | 11 | FLQIYKQGGFL → VSIGLSFPMLP in isoform 5. | VSP_003288 | ||||||||||||||||||||||
| Alternative sequence | 1088 – 1255 | 168 | Missing in isoform 5. | VSP_003289 | ||||||||||||||||||||||
| Natural variant | 1117 | 1 | V → M. Ref.11 Ref.13 Corresponds to variant rs1611770 [ dbSNP | Ensembl ]. | VAR_019390 | ||||||||||||||||||||||
| Natural variant | 1142 | 1 | S → N. Ref.13 Corresponds to variant rs11465207 [ dbSNP | Ensembl ]. | VAR_019391 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Mutagenesis | 1098 | 1 | S → A, D, E, F, G, H, I, K, L, M, N, P, Q, R, V, W or Y: Completely abrogates cleavage. Ref.23 | |||||||||||||||||||||||
| Mutagenesis | 1098 | 1 | S → C or T: Almost complete cleavage. Ref.23 | |||||||||||||||||||||||
| Mutagenesis | 1116 | 1 | D → A: Greatly reduced formation of isoform 5/isoform 7 complex. Ref.33 | |||||||||||||||||||||||
| Mutagenesis | 1116 | 1 | D → E: No effect on formation of isoform 5/isoform 7 complex. Ref.33 | |||||||||||||||||||||||
| Mutagenesis | 1184 | 1 | C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited and AP1S1 binding reduced by 30%; when associated with C-1186. Accumulates in intracellular compartments; when associated with C-1186 and N-1203. Ref.52 | |||||||||||||||||||||||
| Mutagenesis | 1186 | 1 | C → A: S-palmitoylation reduced by 50%. Complete loss of palmitoylation, no effect on endocytosis, recycling inhibited, and AP1S1 binding reduced by 30%; when associated with C-1184. Accumulates in intracellular compartments; when associated with C-1184 and N-1203. Ref.52 | |||||||||||||||||||||||
| Mutagenesis | 1187 – 1189 | 3 | RRK → AAA: No nuclear targeting of HRG-stimulated MUC1 C-terminal nor JUP/gamma-catenin. No effect on interaction with JUP/gamma-catenin. Ref.45 Ref.52 | |||||||||||||||||||||||
| Mutagenesis | 1187 – 1189 | 3 | RRK → QQQ: No effect on palmitoylation. Ref.45 Ref.52 | |||||||||||||||||||||||
| Mutagenesis | 1191 | 1 | Y → F: No effect on EGFR-mediated phosphorylation. Ref.38 Ref.46 | |||||||||||||||||||||||
| Mutagenesis | 1191 | 1 | Y → N: No effect on endocytosis. Ref.38 Ref.46 | |||||||||||||||||||||||
| Mutagenesis | 1203 | 1 | Y → E: No effect on nuclear colocalization of MUC1CT and CTNNB1. No effect on in vitro PDFGR-induced cell invasiveness. Ref.38 Ref.46 Ref.52 Ref.56 | |||||||||||||||||||||||
| Mutagenesis | 1203 | 1 | Y → F: No effect on EGFR-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-induced cell invasiveness. Ref.38 Ref.46 Ref.52 Ref.56 | |||||||||||||||||||||||
| Mutagenesis | 1203 | 1 | Y → N: Reduced endocytosis by 30%. Greatly reduced binding to AP1S2 and GRB2. Binding AP1S1 reduced by 25%. Reduced endocytosis by 77%; when associated with N-1243. Accumulates in intracellular compartments; when associated with C-1184 and C-1186. Ref.38 Ref.46 Ref.52 Ref.56 | |||||||||||||||||||||||
| Mutagenesis | 1209 | 1 | Y → F: Some reduction in EGFR-mediated phosphorylation. Ref.38 | |||||||||||||||||||||||
| Mutagenesis | 1218 | 1 | Y → F: No effect on EGFR-mediated phosphorylation. No nuclear colocalization of MUC1CT and CTNNB1. Ref.38 Ref.56 | |||||||||||||||||||||||
| Mutagenesis | 1223 | 1 | S → A: No change in PRKCD- nor GSK3B-mediated phosphorylation. Ref.32 Ref.39 | |||||||||||||||||||||||
| Mutagenesis | 1224 | 1 | T → A: Loss of PRKCD-mediated phosphorylation. Decreased PRKCD binding. No increased binding to CTNNB1 in the presence of autophosphorylated PRKCD. Increases formation of E-cadherin/beta-catenin complex. Ref.39 | |||||||||||||||||||||||
| Mutagenesis | 1227 | 1 | S → A: No change in PRKCD-mediated phosphorylation. Loss of GSK3B-mediated phosphorylation. CTNNB1. Ref.32 Ref.39 | |||||||||||||||||||||||
| Mutagenesis | 1229 | 1 | Y → F: Greatly reduced EGFR- and Src-mediated phosphorylation. No nuclear localization of MUC1CT. Reduced in vitro PDGFR-mediated phosphorylation. Decreased Src-binding. Ref.36 Ref.38 Ref.42 Ref.46 | |||||||||||||||||||||||
| Mutagenesis | 1229 | 1 | Y → N: No effect on endocytosis. Ref.36 Ref.38 Ref.42 Ref.46 | |||||||||||||||||||||||
| Mutagenesis | 1243 | 1 | Y → N: Reduces binding to AP1S2 by 33%. Greatly reduced binding to GRB2. Reduced endocytosis by 50%. Reduced endocytosis by 77%; when associated with N-1203. Ref.46 | |||||||||||||||||||||||
| Sequence conflict | 2 | 1 | T → A in AAD14369. Ref.20 | |||||||||||||||||||||||
| Sequence conflict | 134 | 1 | P → Q in AAA35757. Ref.18 | |||||||||||||||||||||||
| Sequence conflict | 154 | 1 | P → Q Ref.18 | |||||||||||||||||||||||
| Sequence conflict | 1021 | 1 | S → T Ref.2 | |||||||||||||||||||||||
| Sequence conflict | 1021 | 1 | S → T Ref.3 | |||||||||||||||||||||||
| Sequence conflict | 1193 | 1 | Q → L in AAK30142. Ref.11 | |||||||||||||||||||||||
| Sequence conflict | 1231 | 1 | K → T in AAD10858. Ref.9 | |||||||||||||||||||||||
| Sequence conflict | 1251 | 1 | T → A in AAA60019. Ref.1 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 1042 – 1052 | 11 | ||||||||||||||||||||||||
| Helix | 1056 – 1059 | 4 | ||||||||||||||||||||||||
| Helix | 1064 – 1080 | 17 | ||||||||||||||||||||||||
| Turn | 1082 – 1085 | 4 | ||||||||||||||||||||||||
| Beta strand | 1086 – 1096 | 11 | ||||||||||||||||||||||||
| Beta strand | 1099 – 1107 | 9 | ||||||||||||||||||||||||
| Turn | 1109 – 1111 | 3 | ||||||||||||||||||||||||
| Helix | 1114 – 1132 | 19 | ||||||||||||||||||||||||
| Beta strand | 1136 – 1142 | 7 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequencing of a human pancreatic tumor mucin cDNA." Lan M.S., Batra S.K., Qi W.-N., Metzgar R.S., Hollingsworth M.A. J. Biol. Chem. 265:15294-15299(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Pancreatic carcinoma. |
| [2] | "Episialin, a carcinoma-associated mucin, is generated by a polymorphic gene encoding splice variants with alternative amino termini." Ligtenberg M.J.L., Vos H.L., Gennissen A.M.C., Hilkens J. J. Biol. Chem. 265:5573-5578(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Molecular cloning and expression of human tumor-associated polymorphic epithelial mucin." Gendler S.J., Lancaster C.A., Taylor-Papadimitriou J., Duhig T., Peat N., Burchell J., Pemberton L., Lalani E.-N., Wilson D. J. Biol. Chem. 265:15286-15293(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Mammary carcinoma. |
| [4] | "Structure and expression of the human polymorphic epithelial mucin gene: an expressed VNTR unit." Lancaster C.A., Peat N., Duhig T., Wilson D., Taylor-Papadimitriou J., Gendler S.J. Biochem. Biophys. Res. Commun. 173:1019-1029(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [5] | "Human epithelial tumor antigen cDNA sequences. Differential splicing may generate multiple protein forms." Wreschner D.H., Hareuveni M., Tsarfaty I., Smorodinsky N., Horev J., Zaretsky J., Kotkes P., Weiss M., Lathe R., Dion A., Keydar I. Eur. J. Biochem. 189:463-473(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Mammary carcinoma. |
| [6] | "A transcribed gene, containing a variable number of tandem repeats, codes for a human epithelial tumor antigen. cDNA cloning, expression of the transfected gene and over-expression in breast cancer tissue." Hareuveni M., Tsarfaty I., Zaretsky J., Kotkes P., Horev J., Zrihan S., Weiss M., Green S., Lathe R., Keydar I., Wreschner D.H. Eur. J. Biochem. 189:475-486(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Mammary carcinoma. |
| [7] | "Isolation and characterization of an expressed hypervariable gene coding for a breast-cancer-associated antigen." Tsarfaty I., Hareuveni M., Horev J., Zaretsky J., Weiss M., Jeltsch J.-M., Garnier J.-M., Lathe R., Keydar I., Wreschner D.H. Gene 93:313-318(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [8] | "Characterization and molecular cloning of a novel MUC1 protein, devoid of tandem repeats, expressed in human breast cancer tissue." Zrihan-Licht S., Vos H.L., Baruch A., Elroy-Stein O., Sagiv D., Keydar I., Hilkens J., Wreschner D.H. Eur. J. Biochem. 224:787-795(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). |
| [9] | "Comparison of MUC-1 mucin expression in epithelial and non-epithelial cancer cell lines and demonstration of a new short variant form (MUC-1/Z)." Oosterkamp H.M., Scheiner L., Stefanova M.C., Lloyd K.O., Finstad C.L. Int. J. Cancer 72:87-94(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6; 7 AND 8), TISSUE SPECIFICITY. |
| [10] | "Cloning of a new potential secreted short variant form of MUC1 mucin in epithelial cancer cell line." Zhang L.X., Li C.H., Sun L.Y., Yue W. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 9). Tissue: Carcinoma. |
| [11] | "Soluble expression of peptide containing MUC1/Y-specific epitope in Escherichia coli and preparation of the antibody." Zhang L.X., Li C.H., Sun L.Y., Wang M., Lu H.J. Sheng Wu Gong Cheng Xue Bao 19:337-342(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), VARIANT MET-1117. Tissue: Cervix carcinoma. |
| [12] | "Cloning of a new MUC1 short variant mRNA F from HeLa cells." Zhang L.X., Lu H.J. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10). |
| [13] | NIEHS SNPs program Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS MET-1117 AND ASN-1142. |
| [14] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [16] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). |
| [17] | "A highly immunogenic region of a human polymorphic epithelial mucin expressed by carcinomas is made up of tandem repeats." Gendler S.J., Taylor-Papadimitriou J., Duhig T., Rothbard J., Burchell J. J. Biol. Chem. 263:12820-12823(1988) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA]. |
| [18] | "Sequence analysis of the 5' region of the human DF3 breast carcinoma-associated antigen gene." Abe M., Siddiqui J., Kufe D. Biochem. Biophys. Res. Commun. 165:644-649(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-160 (ISOFORM 2). |
| [19] | "Preoperative diagnosis of thyroid papillary carcinoma by reverse transcriptase polymerase chain reaction of the MUC1 gene." Weiss M., Baruch A., Keydar I., Wreschner D.H. Int. J. Cancer 66:55-59(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-109 (ISOFORM 2). Tissue: Thyroid. |
| [20] | "Mucin mRNA expression in lung adenocarcinoma cell lines and tissues." Yu C.J., Yang P.C., Shew J.Y., Hong T.M., Yang S.C., Lee Y.C., Lee L.N., Luh K.T., Wu C.W. Oncology 53:118-126(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-89. Tissue: Lung. |
| [21] | Buluwela L., Liu Q., Luqmani Y.A., Gomm J.J., Coombes R.C. Submitted (OCT-1992) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-46 (ISOFORMS 3 AND 4). Tissue: Mammary carcinoma. |
| [22] | "Identification of MUC1 proteolytic cleavage sites in vivo." Parry S., Silverman H.S., McDermott K., Willis A., Hollingsworth M.A., Harris A. Biochem. Biophys. Res. Commun. 283:715-720(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 24-33; 28-37 AND 1098-1107, PROTEOLYTIC PROCESSING. |
| [23] | "The MUC1 SEA module is a self-cleaving domain." Levitin F., Stern O., Weiss M., Gil-Henn C., Ziv R., Prokocimer Z., Smorodinsky N.I., Rubinstein D.B., Wreschner D.H. J. Biol. Chem. 280:33374-33386(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 1098-1111, PROTEOLYTIC CLEAVAGE, MUTAGENESIS OF SER-1098. |
| [24] | "High density O-glycosylation on tandem repeat peptide from secretory MUC1 of T47D breast cancer cells." Mueller S., Alving K., Peter-Katalinic J., Zachara N., Gooley A.A., Hanisch F.-G. J. Biol. Chem. 274:18165-18172(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF TANDEM REPEAT, MASS SPECTROMETRY, GLYCOSYLATION. |
| [25] | "Tyrosine phosphorylation of the MUC1 breast cancer membrane proteins. Cytokine receptor-like molecules." Zrihan-Licht S., Baruch A., Elroy-Stein O., Keydar I., Wreschner D.H. FEBS Lett. 356:130-136(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [26] | "Association of the DF3/MUC1 breast cancer antigen with Grb2 and the Sos/Ras exchange protein." Pandey P., Kharbanda S., Kufe D. Cancer Res. 55:4000-4003(1995) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH SOS1 AND GRB2, INTERACTION WITH GRB2 AND SOS1, PHOSPHORYLATION. |
| [27] | "Studies on the order and site specificity of GalNAc transfer to MUC1 tandem repeats by UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase from milk or mammary carcinoma cells." Stadie T.R., Chai W., Lawson A.M., Byfield P.G., Hanisch F.G. Eur. J. Biochem. 229:140-147(1995) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-131 AND THR-139, MASS SPECTROMETRY. |
| [28] | "Interaction of the DF3/MUC1 breast carcinoma-associated antigen and beta-catenin in cell adhesion." Yamamoto M., Bharti A., Li Y., Kufe D. J. Biol. Chem. 272:12492-12494(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNB1 AND JUP, FUNCTION. |
| [29] | "Localization of O-glycosylation sites on glycopeptide fragments from lactation-associated MUC1. All putative sites within the tandem repeat are glycosylation targets in vivo." Mueller S., Goletz S., Packer N.H., Gooley A.A., Lawson A.M., Hanisch F.-G. J. Biol. Chem. 272:24780-24793(1997) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION WITHIN TANDEM REPEAT. |
| [30] | "Developmental expression of mucin genes in the human gastrointestinal system." Reid C.J., Harris A. Gut 42:220-226(1998) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [31] | "Localization of O-glycosylation sites of MUC1 tandem repeats by QTOF ESI mass spectrometry." Hanisch F.G., Green B.N., Bateman R., Peter-Katalinic J. J. Mass Spectrom. 33:358-362(1998) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT THR-131 AND THR-139, MASS SPECTROMETRY. |
| [32] | "Interaction of glycogen synthase kinase 3beta with the DF3/MUC1 carcinoma-associated antigen and beta-catenin." Li Y., Bharti A., Chen D., Gong J., Kufe D. Mol. Cell. Biol. 18:7216-7224(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GSK3B AND CTNNB1, PHOSPHORYLATION AT SER-1227, MUTAGENESIS OF SER-1223 AND SER-1227. |
| [33] | "The breast cancer-associated MUC1 gene generates both a receptor and its cognate binding protein." Baruch A., Hartmann M.-L., Yoeli M., Adereth Y., Greenstein S., Stadler Y., Skornik Y., Zaretsky J., Smorodinsky N.I., Keydar I., Wreschner D.H. Cancer Res. 59:1552-1561(1999) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION (ISOFORM Y), MUTAGENESIS OF ASP-1116. |
| [34] | "MUC1 mucin core protein binds to the domain 1 of ICAM-1." Hayashi T., Takahashi T., Motoya S., Ishida T., Itoh F., Adachi M., Hinoda Y., Imai K. Digestion 63 Suppl. 1:87-92(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ICAM1. |
| [35] | "Mucin MUC1 is seen in cell surface protrusions together with ezrin in immunoelectron tomography and is concentrated at tips of filopodial protrusions in MCF-7 breast carcinoma cells." Bennett R. Jr., Jaervelae T., Engelhardt P., Kostamovaara L., Sparks P., Carpen O., Turunen O., Vaheri A. J. Histochem. Cytochem. 49:67-77(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [36] | "The c-Src tyrosine kinase regulates signaling of the human DF3/MUC1 carcinoma-associated antigen with GSK3 beta and beta-catenin." Li Y., Kuwahara H., Ren J., Wen G., Kufe D. J. Biol. Chem. 276:6061-6064(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SRC; GSK3B AND CTNNB1, PHOSPHORYLATION AT TYR-1229, MUTAGENESIS OF TYR-1229. |
| [37] | "Identification and topology of variant sequences within individual repeat domains of the human epithelial tumor mucin MUC1." Engelmann K., Baldus S.E., Hanisch F.-G. J. Biol. Chem. 276:27764-27769(2001) [PubMed] [Europe PMC] [Abstract] Cited for: POLYMORPHISM WITHIN THE REPEAT. |
| [38] | "The epidermal growth factor receptor regulates interaction of the human DF3/MUC1 carcinoma antigen with c-Src and beta-catenin." Li Y., Ren J., Yu W., Li Q., Kuwahara H., Yin L., Carraway K.L. III, Kufe D. J. Biol. Chem. 276:35239-35242(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EGFR, PHOSPHORYLATION AT TYR-1229 BY EGFR, MUTAGENESIS OF TYR-1191; TYR-1203; TYR-1209; TYR-1218 AND TYR-1229. |
| [39] | "Protein kinase C delta regulates function of the DF3/MUC1 carcinoma antigen in beta-catenin signaling." Ren J., Li Y., Kufe D. J. Biol. Chem. 277:17616-17622(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-1224, INTERACTION WITH PRKCD, FUNCTION, MUTAGENESIS OF SER-1223; THR-1224 AND SER-1227. |
| [40] | "Identification of four sites of stimulated tyrosine phosphorylation in the MUC1 cytoplasmic tail." Wang H., Lillehoj E.P., Kim K.C. Biochem. Biophys. Res. Commun. 310:341-346(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-1203; TYR-1212; TYR-1229 AND TYR-1243. |
| [41] | "DF3/MUC1 signaling in multiple myeloma cells is regulated by interleukin-7." Li Y., Chen W., Ren J., Yu W.H., Li Q., Yoshida K., Kufe D. Cancer Biol. Ther. 2:187-193(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LYN, PHOSPHORYLATION. |
| [42] | "MUC1 cytoplasmic domain coactivates Wnt target gene transcription and confers transformation." Huang L., Ren J., Chen D., Li Y., Kharbanda S., Kufe D. Cancer Biol. Ther. 2:702-706(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNB1, FUNCTION, MUTAGENESIS OF TYR-1229. |
| [43] | "Tumor necrosis factor-alpha converting enzyme/ADAM 17 mediates MUC1 shedding." Thathiah A., Blobel C.P., Carson D.D. J. Biol. Chem. 278:3386-3394(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ADAM17, CLEAVAGE. |
| [44] | "Nuclear association of the cytoplasmic tail of MUC1 and beta-catenin." Wen Y., Caffrey T.C., Wheelock M.J., Johnson K.R., Hollingsworth M.A. J. Biol. Chem. 278:38029-38039(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNB1, SUBCELLULAR LOCATION. |
| [45] | "Heregulin targets gamma-catenin to the nucleolus by a mechanism dependent on the DF3/MUC1 oncoprotein." Li Y., Yu W.-H., Ren J., Chen W., Huang L., Kharbanda S., Loda M., Kufe D. Mol. Cancer Res. 1:765-775(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ERBB2; ERBB3 AND ERBB4, SUBCELLULAR LOCATION, MUTAGENESIS OF 1187-ARG--LYS-1189. |
| [46] | "MUC1 membrane trafficking is modulated by multiple interactions." Kinlough C.L., Poland P.A., Bruns J.B., Harkleroad K.L., Hughey R.P. J. Biol. Chem. 279:53071-53077(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH AP1S2 AND GRB2, SUBCELLULAR LOCATION, MUTAGENESIS OF TYR-1191; TYR-1203; TYR-1229 AND TYR-1243. |
| [47] | "Human MUC1 oncoprotein regulates p53-responsive gene transcription in the genotoxic stress response." Wei X., Xu H., Kufe D. Cancer Cell 7:167-178(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TP53, FUNCTION. |
| [48] | "MUC1 oncoprotein blocks glycogen synthase kinase 3beta-mediated phosphorylation and degradation of beta-catenin." Huang L., Chen D., Liu D., Yin L., Kharbanda S., Kufe D. Cancer Res. 65:10413-10422(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GSK3B, PHOSPHORYLATION, FUNCTION. |
| [49] | Erratum Kinlough C.L., Poland P.A., Bruns J.B., Harkleroad K.L., Hughey R.P. J. Biol. Chem. 280:28827-28827(2005) |
| [50] | "Transmembrane and secreted MUC1 probes show trafficking-dependent changes in O-glycan core profiles." Engelmann K., Kinlough C.L., Muller S., Razawi H., Baldus S.E., Hughey R.P., Hanisch F.-G. Glycobiology 15:1111-1124(2005) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY, SUBCELLULAR LOCATION. |
| [51] | "MUC1 (CD227) interacts with lck tyrosine kinase in Jurkat lymphoma cells and normal T cells." Mukherjee P., Tinder T.L., Basu G.D., Gendler S.J. J. Leukoc. Biol. 77:90-99(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LCK, PHOSPHORYLATION, FUNCTION, TISSUE SPECIFICITY. |
| [52] | "Recycling of MUC1 is dependent on its palmitoylation." Kinlough C.L., McMahan R.J., Poland P.A., Bruns J.B., Harkleroad K.L., Stremple R.J., Kashlan O.B., Weixel K.M., Weisz O.A., Hughey R.P. J. Biol. Chem. 281:12112-12122(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PALMITOYLATION AT CYS-1184 AND CYS-1186, SUBCELLULAR LOCATION, INTERACTION WITH AP1S1 AND AP1S2, MUTAGENESIS OF CYS-1184; CYS-1186; TYR-1203 AND 1187-ARG--LYS-1189. |
| [53] | "MUC1 oncoprotein stabilizes and activates estrogen receptor alpha." Wei X., Xu H., Kufe D. Mol. Cell 21:295-305(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ESR1. |
| [54] | "MUC1 inhibits cell proliferation by a beta-catenin-dependent mechanism." Lillehoj E.P., Lu W., Kiser T., Goldblum S.E., Kim K.C. Biochim. Biophys. Acta 1773:1028-1038(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNB1, SUBCELLULAR LOCATION, FUNCTION. |
| [55] | "Human mucin 1 oncoprotein represses transcription of the p53 tumor suppressor gene." Wei X., Xu H., Kufe D. Cancer Res. 67:1853-1858(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KLF4, FUNCTION. |
| [56] | "Platelet-derived growth factor receptor beta-mediated phosphorylation of MUC1 enhances invasiveness in pancreatic adenocarcinoma cells." Singh P.K., Wen Y., Swanson B.J., Shanmugam K., Kazlauskas A., Cerny R.L., Gendler S.J., Hollingsworth M.A. Cancer Res. 67:5201-5210(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-1203; TYR-1218 AND TYR-1229, MUTAGENESIS OF TYR-1203 AND TYR-1218, SUBCELLULAR LOCATION, MASS SPECTROMETRY. |
| [57] | "MUC1 is a novel regulator of ErbB1 receptor trafficking." Pochampalli M.R., el Bejjani R.M., Schroeder J.A. Oncogene 26:1693-1701(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EGFR, FUNCTION. |
| [58] | "CA 15-3: uses and limitation as a biomarker for breast cancer." Duffy M.J., Evoy D., McDermott E.W. Clin. Chim. Acta 411:1869-1874(2010) [PubMed] [Europe PMC] [Abstract] Cited for: MARKER IN BREAST CANCER. |
| [59] | "N-glycosylation of the MUC1 mucin in epithelial cells and secretions." Parry S., Hanisch F.G., Leir S.H., Sutton-Smith M., Morris H.R., Dell A., Harris A. Glycobiology 16:623-634(2006) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1041-1097 AND 1098-1152 OF WILD TYPE AND MUTANT ALA-1098, MASS SPECTROMETRY, STRUCTURE OF CARBOHYDRATES, AUTOCATALYTIC CLEAVAGE. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | J05582 mRNA. Translation: AAA60019.1. M32738 mRNA. Translation: AAA35804.1. M32739 mRNA. Translation: AAA35806.1. M34089 mRNA. Translation: AAA35807.1. M34088 mRNA. Translation: AAA35805.1. J05581 mRNA. Translation: AAA59876.1. M61170 Genomic DNA. Translation: AAB53150.1. X52229 mRNA. Translation: CAA36478.1. Sequence problems. X52228 mRNA. Translation: CAA36477.1. Sequence problems. M35093 Genomic DNA. Translation: AAB59612.1. Sequence problems. X80761 mRNA. Translation: CAA56734.1. U60259 mRNA. Translation: AAD10856.1. U60260 mRNA. Translation: AAD10857.1. U60261 mRNA. Translation: AAD10858.1. AF125525 mRNA. Translation: AAD27842.1. AF348143 mRNA. Translation: AAK30142.1. AY327582 mRNA. Translation: AAP97013.1. AY463543 Genomic DNA. Translation: AAR18816.1. AL713999 Genomic DNA. Translation: CAI95071.1. AL713999 Genomic DNA. Translation: CAI95073.1. AL713999 Genomic DNA. Translation: CAI95074.1. AL713999 Genomic DNA. Translation: CAI95080.1. CH471121 Genomic DNA. Translation: EAW53116.1. CH471121 Genomic DNA. Translation: EAW53118.1. CH471121 Genomic DNA. Translation: EAW53119.1. BC120974 mRNA. Translation: AAI20975.1. Z17324 mRNA. Translation: CAA78972.1. Z17325 mRNA. Translation: CAA78973.1. M31823 mRNA. Translation: AAA35757.1. S81781 mRNA. Translation: AAD14376.1. Different initiation. S81736 mRNA. Translation: AAD14369.1. Different initiation. M21868 mRNA. Translation: AAA59874.1. Sequence problems. | ||||||||||||||||||||||||
| IPI | IPI00013955. IPI00218163. IPI00218164. IPI00218165. IPI00218166. IPI00218168. IPI00218169. IPI00607673. IPI00902840. IPI00978078. | ||||||||||||||||||||||||
| PIR | A35175. | ||||||||||||||||||||||||
| RefSeq | NP_001018016.1. NM_001018016.2. NP_001018017.1. NM_001018017.2. NP_001037855.1. NM_001044390.2. NP_001037856.1. NM_001044391.2. NP_001037857.1. NM_001044392.2. NP_001037858.1. NM_001044393.2. NP_001191214.1. NM_001204285.1. NP_001191215.1. NM_001204286.1. NP_001191216.1. NM_001204287.1. NP_001191217.1. NM_001204288.1. NP_001191218.1. NM_001204289.1. NP_001191219.1. NM_001204290.1. NP_001191220.1. NM_001204291.1. NP_001191221.1. NM_001204292.1. NP_001191222.1. NM_001204293.1. NP_001191223.1. NM_001204294.1. NP_001191224.1. NM_001204295.1. NP_001191225.1. NM_001204296.1. NP_001191226.1. NM_001204297.1. NP_002447.4. NM_002456.5. | ||||||||||||||||||||||||
| UniGene | Hs.89603. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P15941. | ||||||||||||||||||||||||
| SMR | P15941. Positions 1041-1144. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P15941. 5 interactions. | ||||||||||||||||||||||||
| MINT | MINT-156679. | ||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||
| MEROPS | S71.001. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| GlycoSuiteDB | P15941. | ||||||||||||||||||||||||
| PhosphoSite | P15941. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 296439295. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P15941. | ||||||||||||||||||||||||
| PRIDE | P15941. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 4582. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000337604; ENSP00000338983; ENSG00000185499. ENST00000343256; ENSP00000339690; ENSG00000185499. ENST00000368389; ENSP00000357374; ENSG00000185499. ENST00000368390; ENSP00000357375; ENSG00000185499. ENST00000368398; ENSP00000357383; ENSG00000185499. | ||||||||||||||||||||||||
| GeneID | 4582. | ||||||||||||||||||||||||
| KEGG | hsa:4582. | ||||||||||||||||||||||||
| UCSC | uc001fib.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 4582. | ||||||||||||||||||||||||
| GeneCards | GC01M155158. | ||||||||||||||||||||||||
| HGNC | HGNC:7508. MUC1. | ||||||||||||||||||||||||
| HPA | CAB000036. CAB001986. HPA004179. HPA007235. HPA008855. | ||||||||||||||||||||||||
| MIM | 113720. gene. 158340. gene. | ||||||||||||||||||||||||
| neXtProt | NX_P15941. | ||||||||||||||||||||||||
| PharmGKB | PA31309. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG77744. | ||||||||||||||||||||||||
| KO | K06568. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_17015. Metabolism of proteins. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P15941. | ||||||||||||||||||||||||
| Bgee | P15941. | ||||||||||||||||||||||||
| Genevestigator | P15941. | ||||||||||||||||||||||||
| GermOnline | ENSG00000185499. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR023217. Mucin-1. IPR000082. SEA. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR10006. PTHR10006. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF01390. SEA. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00200. SEA. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS50024. SEA. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | MUC1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | P15941. | ||||||||||||||||||||||||
| GenomeRNAi | 4582. | ||||||||||||||||||||||||
| NextBio | 17597. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | MUC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P15941 Secondary accession number(s): B1AVQ8 Q9Y4J2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
