P15884 (ITF2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 143.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor 4 Short name=TCF-4 Alternative name(s): Class B basic helix-loop-helix protein 19 Short name=bHLHb19 Immunoglobulin transcription factor 2 Short name=ITF-2 SL3-3 enhancer factor 2 Short name=SEF-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 667 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor that binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'. |
| Subunit structure | Efficient DNA binding requires dimerization with another bHLH protein. Forms homo- or heterooligomers with myogenin. Interacts with HIVEP2. Interacts with NEUROD2 By similarity. The CTNNB1 and TCF4 complex interacts with PML (isoform PML-4). Ref.13 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Expressed in adult heart, brain, placenta, skeletal muscle and to a lesser extent in the lung. In developing embryonic tissues, expression mostly occurs in the brain. |
| Domain | the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. Ref.11 |
| Involvement in disease | Pitt-Hopkins syndrome (PTHS) [MIM:610954]: A syndrome characterized by mental retardation, wide mouth and distinctive facial features, and intermittent hyperventilation followed by apnea. Features include intellectual disability with severe speech impairment, normal growth parameters at birth, postnatal microcephaly, breathing anomalies, severe motor developmental delay, motor incoordination, ocular anomalies, constipation, seizures, typical behavior and subtle brain abnormalities. |
| Sequence similarities | Contains 1 bHLH (basic helix-loop-helix) domain. |
| Sequence caution | The sequence AAA60310.1 differs from that shown. Reason: Incomplete and probable erroneous sequence. The sequence AAA60312.1 differs from that shown. Reason: Incomplete and probable erroneous sequence. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ASCL1 | P50553 | 7 | EBI-533224,EBI-957042 | |
| CTNNB1 | P35222 | 9 | EBI-533224,EBI-491549 |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform SEF2-1B (identifier: P15884-1) Also known as: B-; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SEF2-1A (identifier: P15884-2) Also known as: A+; The sequence of this isoform differs from the canonical sequence as follows: 1-160: Missing. 161-183: LHSSAMEVQTKKVRKVPPGLPSS → MYCAYTIPGMGGNSLMYYYNGKA 545-545: T → TRSRS | ||||||
| Isoform SEF2-1D (identifier: P15884-3) Also known as: B+; The sequence of this isoform differs from the canonical sequence as follows: 545-545: T → TRSRS | ||||||
| Isoform B+delta (identifier: P15884-4) The sequence of this isoform differs from the canonical sequence as follows: 124-183: Missing. 545-545: T → TRSRS | ||||||
| Isoform B-delta (identifier: P15884-5) The sequence of this isoform differs from the canonical sequence as follows: 124-183: Missing. | ||||||
| Isoform A- (identifier: P15884-6) The sequence of this isoform differs from the canonical sequence as follows: 1-23: MHHQQRMAALGTDKELSDLLDFS → MYCAYTIPGMGGNSLMYYYNGKA 24-123: Missing. 124-183: Missing. | ||||||
| Isoform G- (identifier: P15884-7) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSS → MKDIFFQFIIARVRKCYSLSCLHTLPVVPTLR 33-102: Missing. 123-123: Missing. | ||||||
| Isoform H- (identifier: P15884-8) The sequence of this isoform differs from the canonical sequence as follows: 1-23: MHHQQRMAALGTDKELSDLLDFS → MKFKQCRCSDTGLCCLDHEGKAE 24-123: Missing. | ||||||
| Isoform D- (identifier: P15884-9) The sequence of this isoform differs from the canonical sequence as follows: 1-130: Missing. | ||||||
| Isoform F- (identifier: P15884-10) The sequence of this isoform differs from the canonical sequence as follows: 1-49: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSN → MEEDSRD | ||||||
| Isoform 11 (identifier: P15884-11) The sequence of this isoform differs from the canonical sequence as follows: 1-102: MHHQQRMAAL...PPFVNSRIQS → MKDIFFQFIIARVRKCYSLSCLHTLPVVPTLR 123-123: Missing. 545-545: T → TRSRS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 667 | 667 | Transcription factor 4 | PRO_0000127256 | |||||||
Regions | |||||||||||
| Domain | 564 – 617 | 54 | bHLH | ||||||||
| Region | 1 – 83 | 83 | Essential for MYOD1 inhibition By similarity | ||||||||
| Region | 379 – 400 | 22 | Leucine-zipper | ||||||||
| Region | 619 – 642 | 24 | Class A specific domain | ||||||||
| Motif | 18 – 26 | 9 | 9aaTAD | ||||||||
| Compositional bias | 228 – 231 | 4 | Poly-Ser | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 515 | 1 | Phosphoserine Ref.12 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 160 | 160 | Missing in isoform SEF2-1A. | VSP_030819 | |||||||
| Alternative sequence | 1 – 130 | 130 | Missing in isoform D-. | VSP_045149 | |||||||
| Alternative sequence | 1 – 102 | 102 | MHHQQ…SRIQS → MKDIFFQFIIARVRKCYSLS CLHTLPVVPTLR in isoform 11. | VSP_045150 | |||||||
| Alternative sequence | 1 – 49 | 49 | MHHQQ…FTGSN → MEEDSRD in isoform F-. | VSP_045151 | |||||||
| Alternative sequence | 1 – 32 | 32 | MHHQQ…PPVSS → MKDIFFQFIIARVRKCYSLS CLHTLPVVPTLR in isoform G-. | VSP_044334 | |||||||
| Alternative sequence | 1 – 23 | 23 | MHHQQ…LLDFS → MYCAYTIPGMGGNSLMYYYN GKA in isoform A-. | VSP_044336 | |||||||
| Alternative sequence | 1 – 23 | 23 | MHHQQ…LLDFS → MKFKQCRCSDTGLCCLDHEG KAE in isoform H-. | VSP_044335 | |||||||
| Alternative sequence | 24 – 123 | 100 | Missing in isoform A- and isoform H-. | VSP_044337 | |||||||
| Alternative sequence | 33 – 102 | 70 | Missing in isoform G-. | VSP_044338 | |||||||
| Alternative sequence | 123 | 1 | Missing in isoform G- and isoform 11. | VSP_044339 | |||||||
| Alternative sequence | 124 – 183 | 60 | Missing in isoform A-, isoform B-delta and isoform B+delta. | VSP_044340 | |||||||
| Alternative sequence | 161 – 183 | 23 | LHSSA…GLPSS → MYCAYTIPGMGGNSLMYYYN GKA in isoform SEF2-1A. | VSP_002111 | |||||||
| Alternative sequence | 545 | 1 | T → TRSRS in isoform B+delta, isoform SEF2-1A, isoform SEF2-1D and isoform 11. | VSP_002112 | |||||||
| Natural variant | 358 | 1 | G → V in PTHS. Ref.16 | VAR_066839 | |||||||
| Natural variant | 450 | 1 | M → I. Corresponds to variant rs11660217 [ dbSNP | Ensembl ]. | VAR_049545 | |||||||
| Natural variant | 535 | 1 | D → G in PTHS; loss of function. Ref.17 | VAR_058632 | |||||||
| Natural variant | 565 | 1 | R → W in PTHS. Ref.18 | VAR_066970 | |||||||
| Natural variant | 572 | 1 | R → G in PTHS; loss of function. Ref.17 Ref.18 | VAR_058633 | |||||||
| Natural variant | 572 | 1 | R → Q in PTHS. Ref.18 | VAR_066971 | |||||||
| Natural variant | 574 | 1 | R → H in PTHS. Ref.18 | VAR_066972 | |||||||
| Natural variant | 574 | 1 | R → P in PTHS. Ref.16 Ref.18 | VAR_066840 | |||||||
| Natural variant | 576 | 1 | R → Q in PTHS; loss of function. Ref.14 Ref.17 Ref.18 | VAR_034704 | |||||||
| Natural variant | 576 | 1 | R → W in PTHS. Ref.14 Ref.15 Ref.18 | VAR_034705 | |||||||
| Natural variant | 578 | 1 | R → H in PTHS. Ref.16 | VAR_066841 | |||||||
| Natural variant | 578 | 1 | R → P in PTHS. Ref.18 | VAR_066973 | |||||||
| Natural variant | 583 | 1 | A → P in PTHS. Ref.18 | VAR_066974 | |||||||
| Natural variant | 610 | 1 | A → V in PTHS; loss of function. Ref.17 Ref.18 | VAR_058634 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 46 – 49 | 4 | TGSN → EFGG in CAA36298. Ref.9 | ||||||||
| Sequence conflict | 205 | 1 | Missing in AV761952. Ref.7 | ||||||||
| Sequence conflict | 334 | 1 | P → S in CAA36298. Ref.9 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 15 – 25 | 11 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Helix-loop-helix transcriptional activators bind to a sequence in glucocorticoid response elements of retrovirus enhancers." Corneliussen B., Thornell A., Hallberg B., Grundstroem T. J. Virol. 65:6084-6093(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SEF2-1A; SEF2-1B AND SEF2-1D), ALTERNATIVE SPLICING (ISOFORM SEF2-1C). Tissue: Thymocyte and Thymus. |
| [2] | "Functional diversity of human basic helix-loop-helix transcription factor TCF4 isoforms generated by alternative 5' exon usage and splicing." Sepp M., Kannike K., Eesmaa A., Urb M., Timmusk T. PLoS ONE 6:E22138-E22138(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A-; B-DELTA; B+DELTA; D-; F-; G-; H-; SEF2-1A; SEF2-1B AND SEF2-1D), ALTERNATIVE SPLICING. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SEF2-1A; D-; F- AND 11). Tissue: Brain and Hippocampus. |
| [4] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SEF2-1B AND SEF2-1D). |
| [7] | "MDSDCE06_MDS Homo sapiens cDNA clone MDSDCE06 5',mRNA sequence." Gu J., Zhao M., Huang Q., Xu X., Li Y., Peng Y., Song H., Xiao H., Gu Y., Li N., Qian B., Liu F., Qu J., Gao X., Cheng Z., Xu Z., Zeng L., Xu S. Chen Z.Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-278 (ISOFORM SEF2-1A). |
| [8] | "A novel, heritable, expanding CTG repeat in an intron of the SEF2-1 gene on chromosome 18q21.1." Breschel T.S., McInnis M.G., Margolis R.L., Sirugo G., Corneliussen B., Simpson S.G., McMahon F.J., Mackinnon D.F., Xu J.F., Pleasant N., Huo Y., Ashworth R.G., Grundstrom C., Grundstrom T., Kidd K.K., Depaulo J.R., Ross C.A. Hum. Mol. Genet. 6:1855-1863(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-48. Tissue: Skin fibroblast. |
| [9] | "Sequence of the cDNA encoding ITF-2, a positive-acting transcription factor." Henthorn P., McCarrick-Walmsley R., Kadesch T. Nucleic Acids Res. 18:678-678(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 46-667 (ISOFORM SEF2-1B). |
| [10] | "Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif." Henthorn P., Kiledjian M., Kadesch T. Science 247:467-470(1990) [PubMed] [Europe PMC] [Abstract] Cited for: DISCUSSION OF SEQUENCE. |
| [11] | "Nine-amino-acid transactivation domain: establishment and prediction utilities." Piskacek S., Gregor M., Nemethova M., Grabner M., Kovarik P., Piskacek M. Genomics 89:756-768(2007) [PubMed] [Europe PMC] [Abstract] Cited for: DOMAIN. |
| [12] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-515, MASS SPECTROMETRY. |
| [13] | "Beta-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells." Satow R., Shitashige M., Jigami T., Fukami K., Honda K., Kitabayashi I., Yamada T. Gastroenterology 142:572-581(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PML. |
| [14] | "Mutations in TCF4, encoding a class I basic helix-loop-helix transcription factor, are responsible for Pitt-Hopkins syndrome, a severe epileptic encephalopathy associated with autonomic dysfunction." Amiel J., Rio M., de Pontual L., Redon R., Malan V., Boddaert N., Plouin P., Carter N.P., Lyonnet S., Munnich A., Colleaux L. Am. J. Hum. Genet. 80:988-993(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PTHS TRP-576 AND GLN-576. |
| [15] | "Haploinsufficiency of TCF4 causes syndromal mental retardation with intermittent hyperventilation (Pitt-Hopkins syndrome)." Zweier C., Peippo M.M., Hoyer J., Sousa S., Bottani A., Clayton-Smith J., Reardon W., Saraiva J., Cabral A., Goehring I., Devriendt K., de Ravel T., Bijlsma E.K., Hennekam R.C.M., Orrico A., Cohen M., Dreweke A., Reis A., Nuernberg P., Rauch A. Am. J. Hum. Genet. 80:994-1001(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PTHS TRP-576. |
| [16] | "Further delineation of Pitt-Hopkins syndrome: phenotypic and genotypic description of 16 novel patients." Zweier C., Sticht H., Bijlsma E.K., Clayton-Smith J., Boonen S.E., Fryer A., Greally M.T., Hoffmann L., den Hollander N.S., Jongmans M., Kant S.G., King M.D., Lynch S.A., McKee S., Midro A.T., Park S.M., Ricotti V., Tarantino E. Rauch A.J. Med. Genet. 45:738-744(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PTHS VAL-358; PRO-574 AND HIS-578. |
| [17] | "Mutational, functional, and expression studies of the TCF4 gene in Pitt-Hopkins syndrome." de Pontual L., Mathieu Y., Golzio C., Rio M., Malan V., Boddaert N., Soufflet C., Picard C., Durandy A., Dobbie A., Heron D., Isidor B., Motte J., Newburry-Ecob R., Pasquier L., Tardieu M., Viot G., Jaubert F. Amiel J.Hum. Mutat. 30:669-676(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PTHS GLY-535; GLY-572; GLN-576 AND VAL-610, CHARACTERIZATION OF VARIANTS PTHS GLY-535; GLY-572; GLN-576 AND VAL-610. |
| [18] | "Novel comprehensive diagnostic strategy in Pitt-Hopkins syndrome: clinical score and further delineation of the TCF4 mutational spectrum." Whalen S., Heron D., Gaillon T., Moldovan O., Rossi M., Devillard F., Giuliano F., Soares G., Mathieu-Dramard M., Afenjar A., Charles P., Mignot C., Burglen L., Van Maldergem L., Piard J., Aftimos S., Mancini G., Dias P. Giurgea I.Hum. Mutat. 33:64-72(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PTHS TRP-565; GLY-572; GLN-572; HIS-574; PRO-574; TRP-576; GLN-576; PRO-578; PRO-583 AND VAL-610. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M74718 mRNA. Translation: AAA60310.1. Sequence problems. M74719 mRNA. Translation: AAA60311.1. M74720 mRNA. Translation: AAA60312.1. Sequence problems. FR748210 mRNA. Translation: CBY80189.1. FR748211 mRNA. Translation: CBY80190.1. FR748212 mRNA. Translation: CBY80191.1. FR748213 mRNA. Translation: CBY80192.1. FR748217 mRNA. Translation: CBY80196.1. FR748218 mRNA. Translation: CBY80197.1. FR748219 mRNA. Translation: CBY80198.1. FR748220 mRNA. Translation: CBY80199.1. FR748221 mRNA. Translation: CBY80200.1. FR748222 mRNA. Translation: CBY80201.1. AK095041 mRNA. Translation: BAG52974.1. AK096862 mRNA. Translation: BAG53382.1. AK300636 mRNA. Translation: BAG62325.1. AK300038 mRNA. Translation: BAG61849.1. AK300612 mRNA. Translation: BAH13314.1. AK316165 mRNA. Translation: BAH14536.1. AC013587 Genomic DNA. No translation available. AC018994 Genomic DNA. No translation available. AC090383 Genomic DNA. No translation available. AC090684 Genomic DNA. No translation available. AC091103 Genomic DNA. No translation available. CH471096 Genomic DNA. Translation: EAW63017.1. CH471096 Genomic DNA. Translation: EAW63018.1. BC125084 mRNA. Translation: AAI25085.1. BC125085 mRNA. Translation: AAI25086.1. AV761952 mRNA. No translation available. U75701 Genomic DNA. Translation: AAC51824.1. X52079 mRNA. Translation: CAA36298.1. | ||||||||||||
| IPI | IPI00013492. IPI00221260. IPI00221261. | ||||||||||||
| PIR | A41311. | ||||||||||||
| RefSeq | NP_001077431.1. NM_001083962.1. NP_001230160.1. NM_001243231.1. NP_001230161.1. NM_001243232.1. NP_001230162.1. NM_001243233.1. NP_001230163.1. NM_001243234.1. NP_001230164.1. NM_001243235.1. NP_001230165.1. NM_001243236.1. NP_003190.1. NM_003199.2. | ||||||||||||
| UniGene | Hs.605153. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| DisProt | DP00224. | ||||||||||||
| ProteinModelPortal | P15884. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-163N. | ||||||||||||
| IntAct | P15884. 10 interactions. | ||||||||||||
| MINT | MINT-4508073. | ||||||||||||
| STRING | 9606.ENSP00000346440. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P15884. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 3915747. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P15884. | ||||||||||||
| PRIDE | P15884. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000354452; ENSP00000346440; ENSG00000196628. ENST00000356073; ENSP00000348374; ENSG00000196628. ENST00000457482; ENSP00000409447; ENSG00000196628. ENST00000537856; ENSP00000439827; ENSG00000196628. ENST00000543082; ENSP00000439656; ENSG00000196628. ENST00000544241; ENSP00000441562; ENSG00000196628. ENST00000561831; ENSP00000457765; ENSG00000196628. ENST00000561992; ENSP00000455179; ENSG00000196628. ENST00000564228; ENSP00000455261; ENSG00000196628. ENST00000564999; ENSP00000457649; ENSG00000196628. ENST00000565018; ENSP00000455984; ENSG00000196628. ENST00000566279; ENSP00000456125; ENSG00000196628. ENST00000567880; ENSP00000454366; ENSG00000196628. ENST00000570177; ENSP00000454647; ENSG00000196628. ENST00000570287; ENSP00000455763; ENSG00000196628. | ||||||||||||
| GeneID | 6925. | ||||||||||||
| KEGG | hsa:6925. | ||||||||||||
| UCSC | uc002lfw.4. human. uc002lfz.2. human. uc010dph.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6925. | ||||||||||||
| GeneCards | GC18M052889. | ||||||||||||
| HGNC | HGNC:11634. TCF4. | ||||||||||||
| HPA | CAB020722. HPA025958. | ||||||||||||
| MIM | 602272. gene. 610954. phenotype. | ||||||||||||
| neXtProt | NX_P15884. | ||||||||||||
| Orphanet | 672. Pallister-Hall syndrome. 2896. Pitt-Hopkins syndrome. | ||||||||||||
| PharmGKB | PA164742621. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG282899. | ||||||||||||
| HOVERGEN | HBG003854. | ||||||||||||
| KO | K15603. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | wnt_canonical_pathway. Canonical Wnt signaling pathway. ar_pathway. Coregulation of Androgen receptor activity. | ||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P15884. | ||||||||||||
| Bgee | P15884. | ||||||||||||
| CleanEx | HS_TCF4. | ||||||||||||
| Genevestigator | P15884. | ||||||||||||
| GermOnline | ENSG00000196628. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 4.10.280.10. 1 hit. | ||||||||||||
| InterPro | IPR011598. bHLH_dom. [Graphical view] | ||||||||||||
| Pfam | PF00010. HLH. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00353. HLH. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47459. HLH_basic. 1 hit. | ||||||||||||
| PROSITE | PS50888. BHLH. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | TCF4. human. | ||||||||||||
| EvolutionaryTrace | P15884. | ||||||||||||
| GenomeRNAi | 6925. | ||||||||||||
| NextBio | 27093. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ITF2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P15884 Secondary accession number(s): B3KT62 Q15441 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
