Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P15884

- ITF2_HUMAN

UniProt

P15884 - ITF2_HUMAN

Protein

Transcription factor 4

Gene

TCF4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 158 (01 Oct 2014)
      Sequence version 3 (15 Dec 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.By similarity

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. E-box binding Source: UniProtKB
    3. protein binding Source: IntAct
    4. protein C-terminus binding Source: UniProtKB
    5. protein heterodimerization activity Source: UniProtKB
    6. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: BHF-UCL
    7. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
    8. sequence-specific DNA binding RNA polymerase recruiting transcription factor activity Source: BHF-UCL
    9. sequence-specific DNA binding transcription factor activity Source: UniProtKB
    10. TFIIB-class binding transcription factor activity Source: BHF-UCL
    11. TFIIB-class transcription factor binding Source: BHF-UCL

    GO - Biological processi

    1. DNA-templated transcription, initiation Source: BHF-UCL
    2. positive regulation of neuron differentiation Source: UniProtKB
    3. positive regulation of transcription, DNA-templated Source: UniProtKB
    4. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    5. protein-DNA complex assembly Source: BHF-UCL
    6. transcription initiation from RNA polymerase II promoter Source: BHF-UCL

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Differentiation, Neurogenesis, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Enzyme and pathway databases

    ReactomeiREACT_21402. CDO in myogenesis.
    SignaLinkiP15884.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transcription factor 4
    Short name:
    TCF-4
    Alternative name(s):
    Class B basic helix-loop-helix protein 19
    Short name:
    bHLHb19
    Immunoglobulin transcription factor 2
    Short name:
    ITF-2
    SL3-3 enhancer factor 2
    Short name:
    SEF-2
    Gene namesi
    Name:TCF4
    Synonyms:BHLHB19, ITF2, SEF2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:11634. TCF4.

    Subcellular locationi

    Nucleus 1 PublicationPROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleus Source: UniProtKB
    2. transcription factor complex Source: BHF-UCL

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Pitt-Hopkins syndrome (PTHS) [MIM:610954]: A syndrome characterized by mental retardation, wide mouth and distinctive facial features, and intermittent hyperventilation followed by apnea. Features include intellectual disability with severe speech impairment, normal growth parameters at birth, postnatal microcephaly, breathing anomalies, severe motor developmental delay, motor incoordination, ocular anomalies, constipation, seizures, typical behavior and subtle brain abnormalities.6 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti358 – 3581G → V in PTHS; also expressed in the nucleus with a pattern indistinguishable from the wild-type; does not have a major impact on homodimer formation; affects transcriptional activity in a context-dependent manner. 1 Publication
    VAR_066839
    Natural varianti535 – 5351D → G in PTHS; loss of function; also expressed in the nucleus with a pattern indistinguishable from the wild-type; does not have a major impact on homodimer formation; affects transcriptional activity in a context-dependent manner. 1 Publication
    VAR_058632
    Natural varianti565 – 5651R → W in PTHS. 1 Publication
    VAR_066970
    Natural varianti572 – 5721R → G in PTHS; loss of function. 2 Publications
    VAR_058633
    Natural varianti572 – 5721R → Q in PTHS. 1 Publication
    VAR_066971
    Natural varianti574 – 5741R → H in PTHS. 1 Publication
    VAR_066972
    Natural varianti574 – 5741R → P in PTHS; mislocalized to small spherical punctae that are dispersed throughout the nucleus; can attenuate homo- and heterodimer formation; affects transcriptional activity in a context-dependent manner. 2 Publications
    VAR_066840
    Natural varianti576 – 5761R → Q in PTHS; loss of function. 3 Publications
    VAR_034704
    Natural varianti576 – 5761R → W in PTHS; mislocalized to small spherical punctae that are dispersed throughout the nucleus; can attenuate homo- and heterodimer formation; affects transcriptional activity in a context-dependent manner. 3 Publications
    VAR_034705
    Natural varianti578 – 5781R → H in PTHS. 1 Publication
    VAR_066841
    Natural varianti578 – 5781R → P in PTHS. 2 Publications
    VAR_066973
    Natural varianti583 – 5831A → P in PTHS. 1 Publication
    VAR_066974
    Natural varianti610 – 6101A → V in PTHS; loss of function; mislocalized to small spherical punctae that are dispersed throughout the nucleus; can attenuate homo- and heterodimer formation; affects transcriptional activity in a context-dependent manner. 2 Publications
    VAR_058634

    Keywords - Diseasei

    Disease mutation, Epilepsy, Mental retardation, Primary microcephaly

    Organism-specific databases

    MIMi610954. phenotype.
    Orphaneti178469. Autosomal dominant nonsyndromic intellectual disability.
    98974. Fuchs endothelial corneal dystrophy.
    672. Pallister-Hall syndrome.
    2896. Pitt-Hopkins syndrome.
    171. Primary sclerosing cholangitis.
    3140. Schizophrenia.
    PharmGKBiPA164742621.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 667667Transcription factor 4PRO_0000127256Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei515 – 5151Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP15884.
    PaxDbiP15884.
    PRIDEiP15884.

    PTM databases

    PhosphoSiteiP15884.

    Expressioni

    Tissue specificityi

    Expressed in adult heart, brain, placenta, skeletal muscle and to a lesser extent in the lung. In developing embryonic tissues, expression mostly occurs in the brain.

    Gene expression databases

    ArrayExpressiP15884.
    BgeeiP15884.
    CleanExiHS_TCF4.
    GenevestigatoriP15884.

    Organism-specific databases

    HPAiCAB020722.
    HPA025958.

    Interactioni

    Subunit structurei

    Efficient DNA binding requires dimerization with another bHLH protein. Forms homo- or heterooligomers with myogenin. Interacts with HIVEP2. Interacts with NEUROD2 By similarity. Interacts with AGBL1.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ASCL1P505537EBI-533224,EBI-957042
    CTNNB1P3522219EBI-533224,EBI-491549
    ctnnb1P262332EBI-533224,EBI-7373758From a different organism.
    FERMT2Q96AC16EBI-533224,EBI-4399465
    Sox17Q614735EBI-533224,EBI-9106822From a different organism.
    Sox4Q068312EBI-533224,EBI-6262177From a different organism.

    Protein-protein interaction databases

    BioGridi112787. 37 interactions.
    DIPiDIP-163N.
    IntActiP15884. 17 interactions.
    MINTiMINT-4508073.
    STRINGi9606.ENSP00000346440.

    Structurei

    Secondary structure

    1
    667
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi15 – 2511

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2KWFNMR-B11-27[»]
    DisProtiDP00224.
    ProteinModelPortaliP15884.
    SMRiP15884. Positions 565-624.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP15884.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini564 – 61754bHLHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 8383Essential for MYOD1 inhibitionBy similarityAdd
    BLAST
    Regioni379 – 40022Leucine-zipperAdd
    BLAST
    Regioni619 – 64224Class A specific domainAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi18 – 2699aaTAD

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi228 – 2314Poly-Ser

    Domaini

    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication

    Sequence similaritiesi

    Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG282899.
    HOVERGENiHBG003854.
    KOiK15603.
    OrthoDBiEOG72G16Q.
    PhylomeDBiP15884.
    TreeFamiTF321672.

    Family and domain databases

    Gene3Di4.10.280.10. 1 hit.
    InterProiIPR011598. bHLH_dom.
    [Graphical view]
    PfamiPF00010. HLH. 1 hit.
    [Graphical view]
    SMARTiSM00353. HLH. 1 hit.
    [Graphical view]
    SUPFAMiSSF47459. SSF47459. 1 hit.
    PROSITEiPS50888. BHLH. 1 hit.
    [Graphical view]

    Sequences (16)i

    Sequence statusi: Complete.

    This entry describes 16 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform SEF2-1B (identifier: P15884-1) [UniParc]FASTAAdd to Basket

    Also known as: B-

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHHQQRMAAL GTDKELSDLL DFSAMFSPPV SSGKNGPTSL ASGHFTGSNV    50
    EDRSSSGSWG NGGHPSPSRN YGDGTPYDHM TSRDLGSHDN LSPPFVNSRI 100
    QSKTERGSYS SYGRESNLQG CHQQSLLGGD MDMGNPGTLS PTKPGSQYYQ 150
    YSSNNPRRRP LHSSAMEVQT KKVRKVPPGL PSSVYAPSAS TADYNRDSPG 200
    YPSSKPATST FPSSFFMQDG HHSSDPWSSS SGMNQPGYAG MLGNSSHIPQ 250
    SSSYCSLHPH ERLSYPSHSS ADINSSLPPM STFHRSGTNH YSTSSCTPPA 300
    NGTDSIMANR GSGAAGSSQT GDALGKALAS IYSPDHTNNS FSSNPSTPVG 350
    SPPSLSAGTA VWSRNGGQAS SSPNYEGPLH SLQSRIEDRL ERLDDAIHVL 400
    RNHAVGPSTA MPGGHGDMHG IIGPSHNGAM GGLGSGYGTG LLSANRHSLM 450
    VGTHREDGVA LRGSHSLLPN QVPVPQLPVQ SATSPDLNPP QDPYRGMPPG 500
    LQGQSVSSGS SEIKSDDEGD ENLQDTKSSE DKKLDDDKKD IKSITSNNDD 550
    EDLTPEQKAE REKERRMANN ARERLRVRDI NEAFKELGRM VQLHLKSDKP 600
    QTKLLILHQA VAVILSLEQQ VRERNLNPKA ACLKRREEEK VSSEPPPLSL 650
    AGPHPGMGDA SNHMGQM 667
    Length:667
    Mass (Da):71,308
    Last modified:December 15, 1998 - v3
    Checksum:i53459FC7989D9487
    GO
    Isoform SEF2-1A (identifier: P15884-2) [UniParc]FASTAAdd to Basket

    Also known as: A+

    The sequence of this isoform differs from the canonical sequence as follows:
         1-160: Missing.
         161-183: LHSSAMEVQTKKVRKVPPGLPSS → MYCAYTIPGMGGNSLMYYYNGKA
         545-545: T → TRSRS

    Show »
    Length:511
    Mass (Da):54,621
    Checksum:i53BE8B2756C9C26B
    GO
    Isoform SEF2-1D (identifier: P15884-3) [UniParc]FASTAAdd to Basket

    Also known as: B+

    The sequence of this isoform differs from the canonical sequence as follows:
         545-545: T → TRSRS

    Show »
    Length:671
    Mass (Da):71,795
    Checksum:i2A3AE4C1E87B81E4
    GO
    Isoform B+delta (identifier: P15884-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         124-183: Missing.
         545-545: T → TRSRS

    Show »
    Length:611
    Mass (Da):65,282
    Checksum:iC9C6986AA5563828
    GO
    Isoform B-delta (identifier: P15884-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         124-183: Missing.

    Show »
    Length:607
    Mass (Da):64,796
    Checksum:iAE68260B30C1B9E6
    GO
    Isoform A- (identifier: P15884-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-23: MHHQQRMAALGTDKELSDLLDFS → MYCAYTIPGMGGNSLMYYYNGKA
         24-123: Missing.
         124-183: Missing.

    Show »
    Length:507
    Mass (Da):54,135
    Checksum:i2DF7DC48C2D3EE83
    GO
    Isoform G- (identifier: P15884-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSS → MKDIFFQFIIARVRKCYSLSCLHTLPVVPTLR
         33-102: Missing.
         123-123: Missing.

    Show »
    Length:596
    Mass (Da):64,116
    Checksum:i5912C40D16E30908
    GO
    Isoform H- (identifier: P15884-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-23: MHHQQRMAALGTDKELSDLLDFS → MKFKQCRCSDTGLCCLDHEGKAE
         24-123: Missing.

    Show »
    Length:567
    Mass (Da):60,681
    Checksum:iD52C343573CF65BB
    GO
    Isoform D- (identifier: P15884-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-130: Missing.

    Show »
    Length:537
    Mass (Da):57,425
    Checksum:i7F77B2E736AC27E4
    GO
    Isoform F- (identifier: P15884-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-49: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSN → MEEDSRD

    Show »
    Length:625
    Mass (Da):67,027
    Checksum:i36CF6C747000814D
    GO
    Isoform 11 (identifier: P15884-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-102: MHHQQRMAAL...PPFVNSRIQS → MKDIFFQFIIARVRKCYSLSCLHTLPVVPTLR
         123-123: Missing.
         545-545: T → TRSRS

    Show »
    Length:600
    Mass (Da):64,602
    Checksum:iFA530DE0722CDA2E
    GO
    Isoform E- (identifier: P15884-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: MHHQQRMAALGTDKELSDLLDFSA → MQRAKTELFRLQIVTDDLRKNE
         357-357: Missing.

    Show »
    Length:664
    Mass (Da):71,227
    Checksum:i064EA9F64B55C741
    GO
    Isoform 13 (identifier: P15884-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: Missing.
         545-545: T → TRSRS

    Show »
    Length:647
    Mass (Da):69,098
    Checksum:i1ED8C14A73F678C1
    GO
    Isoform C- (identifier: P15884-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: Missing.

    Show »
    Length:643
    Mass (Da):68,611
    Checksum:i68C866E2BBBAB621
    GO
    Isoform C-delta (identifier: P15884-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: Missing.
         124-183: Missing.

    Show »
    Length:583
    Mass (Da):62,099
    Checksum:i6B694DB9DDCB93B6
    GO
    Isoform I- (identifier: P15884-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-216: Missing.

    Show »
    Length:451
    Mass (Da):48,098
    Checksum:iFD0EE9CD3312CFB4
    GO

    Sequence cautioni

    The sequence AAA60310.1 differs from that shown. Reason: Incomplete and probable erroneous sequence.
    The sequence AAA60312.1 differs from that shown. Reason: Incomplete and probable erroneous sequence.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti46 – 494TGSN → EFGG in CAA36298. (PubMed:2308860)Curated
    Sequence conflicti205 – 2051Missing in AV761952. 1 PublicationCurated
    Sequence conflicti334 – 3341P → S in CAA36298. (PubMed:2308860)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti358 – 3581G → V in PTHS; also expressed in the nucleus with a pattern indistinguishable from the wild-type; does not have a major impact on homodimer formation; affects transcriptional activity in a context-dependent manner. 1 Publication
    VAR_066839
    Natural varianti450 – 4501M → I.
    Corresponds to variant rs11660217 [ dbSNP | Ensembl ].
    VAR_049545
    Natural varianti535 – 5351D → G in PTHS; loss of function; also expressed in the nucleus with a pattern indistinguishable from the wild-type; does not have a major impact on homodimer formation; affects transcriptional activity in a context-dependent manner. 1 Publication
    VAR_058632
    Natural varianti565 – 5651R → W in PTHS. 1 Publication
    VAR_066970
    Natural varianti572 – 5721R → G in PTHS; loss of function. 2 Publications
    VAR_058633
    Natural varianti572 – 5721R → Q in PTHS. 1 Publication
    VAR_066971
    Natural varianti574 – 5741R → H in PTHS. 1 Publication
    VAR_066972
    Natural varianti574 – 5741R → P in PTHS; mislocalized to small spherical punctae that are dispersed throughout the nucleus; can attenuate homo- and heterodimer formation; affects transcriptional activity in a context-dependent manner. 2 Publications
    VAR_066840
    Natural varianti576 – 5761R → Q in PTHS; loss of function. 3 Publications
    VAR_034704
    Natural varianti576 – 5761R → W in PTHS; mislocalized to small spherical punctae that are dispersed throughout the nucleus; can attenuate homo- and heterodimer formation; affects transcriptional activity in a context-dependent manner. 3 Publications
    VAR_034705
    Natural varianti578 – 5781R → H in PTHS. 1 Publication
    VAR_066841
    Natural varianti578 – 5781R → P in PTHS. 2 Publications
    VAR_066973
    Natural varianti583 – 5831A → P in PTHS. 1 Publication
    VAR_066974
    Natural varianti610 – 6101A → V in PTHS; loss of function; mislocalized to small spherical punctae that are dispersed throughout the nucleus; can attenuate homo- and heterodimer formation; affects transcriptional activity in a context-dependent manner. 2 Publications
    VAR_058634

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 216216Missing in isoform I-. 1 PublicationVSP_054279Add
    BLAST
    Alternative sequencei1 – 160160Missing in isoform SEF2-1A. 4 PublicationsVSP_030819Add
    BLAST
    Alternative sequencei1 – 130130Missing in isoform D-. 2 PublicationsVSP_045149Add
    BLAST
    Alternative sequencei1 – 102102MHHQQ…SRIQS → MKDIFFQFIIARVRKCYSLS CLHTLPVVPTLR in isoform 11. 1 PublicationVSP_045150Add
    BLAST
    Alternative sequencei1 – 4949MHHQQ…FTGSN → MEEDSRD in isoform F-. 2 PublicationsVSP_045151Add
    BLAST
    Alternative sequencei1 – 3232MHHQQ…PPVSS → MKDIFFQFIIARVRKCYSLS CLHTLPVVPTLR in isoform G-. 1 PublicationVSP_044334Add
    BLAST
    Alternative sequencei1 – 2424Missing in isoform 13, isoform C- and isoform C-delta. 2 PublicationsVSP_047081Add
    BLAST
    Alternative sequencei1 – 2424MHHQQ…LDFSA → MQRAKTELFRLQIVTDDLRK NE in isoform E-. 1 PublicationVSP_047082Add
    BLAST
    Alternative sequencei1 – 2323MHHQQ…LLDFS → MYCAYTIPGMGGNSLMYYYN GKA in isoform A-. 1 PublicationVSP_044336Add
    BLAST
    Alternative sequencei1 – 2323MHHQQ…LLDFS → MKFKQCRCSDTGLCCLDHEG KAE in isoform H-. 1 PublicationVSP_044335Add
    BLAST
    Alternative sequencei24 – 123100Missing in isoform A- and isoform H-. 1 PublicationVSP_044337Add
    BLAST
    Alternative sequencei33 – 10270Missing in isoform G-. 1 PublicationVSP_044338Add
    BLAST
    Alternative sequencei123 – 1231Missing in isoform G- and isoform 11. 2 PublicationsVSP_044339
    Alternative sequencei124 – 18360Missing in isoform A-, isoform B-delta, isoform B+delta and isoform C-delta. 1 PublicationVSP_044340Add
    BLAST
    Alternative sequencei161 – 18323LHSSA…GLPSS → MYCAYTIPGMGGNSLMYYYN GKA in isoform SEF2-1A. 4 PublicationsVSP_002111Add
    BLAST
    Alternative sequencei357 – 3571Missing in isoform E-. 1 PublicationVSP_047083
    Alternative sequencei545 – 5451T → TRSRS in isoform B+delta, isoform SEF2-1A, isoform SEF2-1D, isoform 11 and isoform 13. 5 PublicationsVSP_002112

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M74718 mRNA. Translation: AAA60310.1. Sequence problems.
    M74719 mRNA. Translation: AAA60311.1.
    M74720 mRNA. Translation: AAA60312.1. Sequence problems.
    FR748210 mRNA. Translation: CBY80189.1.
    FR748211 mRNA. Translation: CBY80190.1.
    FR748212 mRNA. Translation: CBY80191.1.
    FR748213 mRNA. Translation: CBY80192.1.
    FR748214 mRNA. Translation: CBY80193.1.
    FR748215 mRNA. Translation: CBY80194.1.
    FR748216 mRNA. Translation: CBY80195.1.
    FR748217 mRNA. Translation: CBY80196.1.
    FR748218 mRNA. Translation: CBY80197.1.
    FR748219 mRNA. Translation: CBY80198.1.
    FR748220 mRNA. Translation: CBY80199.1.
    FR748221 mRNA. Translation: CBY80200.1.
    FR748222 mRNA. Translation: CBY80201.1.
    FR748223 mRNA. Translation: CBY80202.1.
    AK095041 mRNA. Translation: BAG52974.1.
    AK096862 mRNA. Translation: BAG53382.1.
    AK299169 mRNA. Translation: BAH12962.1.
    AK300636 mRNA. Translation: BAG62325.1.
    AK300038 mRNA. Translation: BAG61849.1.
    AK301144 mRNA. Translation: BAH13417.1.
    AK300612 mRNA. Translation: BAH13314.1.
    AK316165 mRNA. Translation: BAH14536.1.
    AC013587 Genomic DNA. No translation available.
    AC018994 Genomic DNA. No translation available.
    AC090383 Genomic DNA. No translation available.
    AC090684 Genomic DNA. No translation available.
    AC091103 Genomic DNA. No translation available.
    CH471096 Genomic DNA. Translation: EAW63017.1.
    CH471096 Genomic DNA. Translation: EAW63018.1.
    BC125084 mRNA. Translation: AAI25085.1.
    BC125085 mRNA. Translation: AAI25086.1.
    AV761952 mRNA. No translation available.
    U75701 Genomic DNA. Translation: AAC51824.1.
    X52079 mRNA. Translation: CAA36298.1.
    CCDSiCCDS11960.1. [P15884-1]
    CCDS42438.1. [P15884-3]
    CCDS58624.1. [P15884-2]
    CCDS58625.1. [P15884-6]
    CCDS58626.1. [P15884-9]
    CCDS58627.1. [P15884-11]
    CCDS58628.1. [P15884-10]
    CCDS58629.1. [P15884-13]
    CCDS59321.1. [P15884-12]
    PIRiA41311.
    RefSeqiNP_001077431.1. NM_001083962.1. [P15884-3]
    NP_001230155.2. NM_001243226.2.
    NP_001230156.1. NM_001243227.1. [P15884-13]
    NP_001230157.1. NM_001243228.1.
    NP_001230159.1. NM_001243230.1. [P15884-12]
    NP_001230160.1. NM_001243231.1. [P15884-10]
    NP_001230161.1. NM_001243232.1. [P15884-11]
    NP_001230162.1. NM_001243233.1. [P15884-9]
    NP_001230163.1. NM_001243234.1. [P15884-2]
    NP_001230164.1. NM_001243235.1. [P15884-6]
    NP_001230165.1. NM_001243236.1.
    NP_003190.1. NM_003199.2. [P15884-1]
    XP_005266800.1. XM_005266743.2. [P15884-13]
    XP_005266801.1. XM_005266744.2. [P15884-13]
    XP_005266803.1. XM_005266746.2. [P15884-14]
    XP_005266807.1. XM_005266750.2. [P15884-7]
    XP_006722599.1. XM_006722536.1. [P15884-3]
    XP_006722600.1. XM_006722537.1. [P15884-3]
    XP_006722603.1. XM_006722540.1. [P15884-9]
    UniGeneiHs.605153.
    Hs.742885.

    Genome annotation databases

    EnsembliENST00000354452; ENSP00000346440; ENSG00000196628. [P15884-3]
    ENST00000356073; ENSP00000348374; ENSG00000196628. [P15884-1]
    ENST00000457482; ENSP00000409447; ENSG00000196628. [P15884-2]
    ENST00000537578; ENSP00000440731; ENSG00000196628. [P15884-13]
    ENST00000537856; ENSP00000439827; ENSG00000196628. [P15884-9]
    ENST00000540999; ENSP00000445202; ENSG00000196628. [P15884-14]
    ENST00000543082; ENSP00000439656; ENSG00000196628. [P15884-10]
    ENST00000544241; ENSP00000441562; ENSG00000196628. [P15884-11]
    ENST00000561831; ENSP00000457765; ENSG00000196628.
    ENST00000561992; ENSP00000455179; ENSG00000196628. [P15884-9]
    ENST00000564228; ENSP00000455261; ENSG00000196628. [P15884-7]
    ENST00000564999; ENSP00000457649; ENSG00000196628. [P15884-1]
    ENST00000565018; ENSP00000455984; ENSG00000196628. [P15884-3]
    ENST00000566279; ENSP00000456125; ENSG00000196628. [P15884-4]
    ENST00000566286; ENSP00000455418; ENSG00000196628. [P15884-12]
    ENST00000567880; ENSP00000454366; ENSG00000196628. [P15884-5]
    ENST00000568673; ENSP00000455135; ENSG00000196628. [P15884-13]
    ENST00000570177; ENSP00000454647; ENSG00000196628. [P15884-9]
    ENST00000570287; ENSP00000455763; ENSG00000196628. [P15884-6]
    GeneIDi6925.
    KEGGihsa:6925.
    UCSCiuc002lfw.4. human. [P15884-2]
    uc002lfx.2. human.
    uc002lfy.2. human.
    uc002lfz.2. human. [P15884-1]
    uc010dph.1. human. [P15884-3]
    uc021ukh.1. human. [P15884-6]
    uc021uki.1. human. [P15884-7]
    uc021ukj.1. human. [P15884-5]
    uc021ukk.1. human. [P15884-4]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M74718 mRNA. Translation: AAA60310.1 . Sequence problems.
    M74719 mRNA. Translation: AAA60311.1 .
    M74720 mRNA. Translation: AAA60312.1 . Sequence problems.
    FR748210 mRNA. Translation: CBY80189.1 .
    FR748211 mRNA. Translation: CBY80190.1 .
    FR748212 mRNA. Translation: CBY80191.1 .
    FR748213 mRNA. Translation: CBY80192.1 .
    FR748214 mRNA. Translation: CBY80193.1 .
    FR748215 mRNA. Translation: CBY80194.1 .
    FR748216 mRNA. Translation: CBY80195.1 .
    FR748217 mRNA. Translation: CBY80196.1 .
    FR748218 mRNA. Translation: CBY80197.1 .
    FR748219 mRNA. Translation: CBY80198.1 .
    FR748220 mRNA. Translation: CBY80199.1 .
    FR748221 mRNA. Translation: CBY80200.1 .
    FR748222 mRNA. Translation: CBY80201.1 .
    FR748223 mRNA. Translation: CBY80202.1 .
    AK095041 mRNA. Translation: BAG52974.1 .
    AK096862 mRNA. Translation: BAG53382.1 .
    AK299169 mRNA. Translation: BAH12962.1 .
    AK300636 mRNA. Translation: BAG62325.1 .
    AK300038 mRNA. Translation: BAG61849.1 .
    AK301144 mRNA. Translation: BAH13417.1 .
    AK300612 mRNA. Translation: BAH13314.1 .
    AK316165 mRNA. Translation: BAH14536.1 .
    AC013587 Genomic DNA. No translation available.
    AC018994 Genomic DNA. No translation available.
    AC090383 Genomic DNA. No translation available.
    AC090684 Genomic DNA. No translation available.
    AC091103 Genomic DNA. No translation available.
    CH471096 Genomic DNA. Translation: EAW63017.1 .
    CH471096 Genomic DNA. Translation: EAW63018.1 .
    BC125084 mRNA. Translation: AAI25085.1 .
    BC125085 mRNA. Translation: AAI25086.1 .
    AV761952 mRNA. No translation available.
    U75701 Genomic DNA. Translation: AAC51824.1 .
    X52079 mRNA. Translation: CAA36298.1 .
    CCDSi CCDS11960.1. [P15884-1 ]
    CCDS42438.1. [P15884-3 ]
    CCDS58624.1. [P15884-2 ]
    CCDS58625.1. [P15884-6 ]
    CCDS58626.1. [P15884-9 ]
    CCDS58627.1. [P15884-11 ]
    CCDS58628.1. [P15884-10 ]
    CCDS58629.1. [P15884-13 ]
    CCDS59321.1. [P15884-12 ]
    PIRi A41311.
    RefSeqi NP_001077431.1. NM_001083962.1. [P15884-3 ]
    NP_001230155.2. NM_001243226.2.
    NP_001230156.1. NM_001243227.1. [P15884-13 ]
    NP_001230157.1. NM_001243228.1.
    NP_001230159.1. NM_001243230.1. [P15884-12 ]
    NP_001230160.1. NM_001243231.1. [P15884-10 ]
    NP_001230161.1. NM_001243232.1. [P15884-11 ]
    NP_001230162.1. NM_001243233.1. [P15884-9 ]
    NP_001230163.1. NM_001243234.1. [P15884-2 ]
    NP_001230164.1. NM_001243235.1. [P15884-6 ]
    NP_001230165.1. NM_001243236.1.
    NP_003190.1. NM_003199.2. [P15884-1 ]
    XP_005266800.1. XM_005266743.2. [P15884-13 ]
    XP_005266801.1. XM_005266744.2. [P15884-13 ]
    XP_005266803.1. XM_005266746.2. [P15884-14 ]
    XP_005266807.1. XM_005266750.2. [P15884-7 ]
    XP_006722599.1. XM_006722536.1. [P15884-3 ]
    XP_006722600.1. XM_006722537.1. [P15884-3 ]
    XP_006722603.1. XM_006722540.1. [P15884-9 ]
    UniGenei Hs.605153.
    Hs.742885.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2KWF NMR - B 11-27 [» ]
    DisProti DP00224.
    ProteinModelPortali P15884.
    SMRi P15884. Positions 565-624.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112787. 37 interactions.
    DIPi DIP-163N.
    IntActi P15884. 17 interactions.
    MINTi MINT-4508073.
    STRINGi 9606.ENSP00000346440.

    PTM databases

    PhosphoSitei P15884.

    Proteomic databases

    MaxQBi P15884.
    PaxDbi P15884.
    PRIDEi P15884.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354452 ; ENSP00000346440 ; ENSG00000196628 . [P15884-3 ]
    ENST00000356073 ; ENSP00000348374 ; ENSG00000196628 . [P15884-1 ]
    ENST00000457482 ; ENSP00000409447 ; ENSG00000196628 . [P15884-2 ]
    ENST00000537578 ; ENSP00000440731 ; ENSG00000196628 . [P15884-13 ]
    ENST00000537856 ; ENSP00000439827 ; ENSG00000196628 . [P15884-9 ]
    ENST00000540999 ; ENSP00000445202 ; ENSG00000196628 . [P15884-14 ]
    ENST00000543082 ; ENSP00000439656 ; ENSG00000196628 . [P15884-10 ]
    ENST00000544241 ; ENSP00000441562 ; ENSG00000196628 . [P15884-11 ]
    ENST00000561831 ; ENSP00000457765 ; ENSG00000196628 .
    ENST00000561992 ; ENSP00000455179 ; ENSG00000196628 . [P15884-9 ]
    ENST00000564228 ; ENSP00000455261 ; ENSG00000196628 . [P15884-7 ]
    ENST00000564999 ; ENSP00000457649 ; ENSG00000196628 . [P15884-1 ]
    ENST00000565018 ; ENSP00000455984 ; ENSG00000196628 . [P15884-3 ]
    ENST00000566279 ; ENSP00000456125 ; ENSG00000196628 . [P15884-4 ]
    ENST00000566286 ; ENSP00000455418 ; ENSG00000196628 . [P15884-12 ]
    ENST00000567880 ; ENSP00000454366 ; ENSG00000196628 . [P15884-5 ]
    ENST00000568673 ; ENSP00000455135 ; ENSG00000196628 . [P15884-13 ]
    ENST00000570177 ; ENSP00000454647 ; ENSG00000196628 . [P15884-9 ]
    ENST00000570287 ; ENSP00000455763 ; ENSG00000196628 . [P15884-6 ]
    GeneIDi 6925.
    KEGGi hsa:6925.
    UCSCi uc002lfw.4. human. [P15884-2 ]
    uc002lfx.2. human.
    uc002lfy.2. human.
    uc002lfz.2. human. [P15884-1 ]
    uc010dph.1. human. [P15884-3 ]
    uc021ukh.1. human. [P15884-6 ]
    uc021uki.1. human. [P15884-7 ]
    uc021ukj.1. human. [P15884-5 ]
    uc021ukk.1. human. [P15884-4 ]

    Organism-specific databases

    CTDi 6925.
    GeneCardsi GC18M052889.
    GeneReviewsi TCF4.
    HGNCi HGNC:11634. TCF4.
    HPAi CAB020722.
    HPA025958.
    MIMi 602272. gene.
    610954. phenotype.
    neXtProti NX_P15884.
    Orphaneti 178469. Autosomal dominant nonsyndromic intellectual disability.
    98974. Fuchs endothelial corneal dystrophy.
    672. Pallister-Hall syndrome.
    2896. Pitt-Hopkins syndrome.
    171. Primary sclerosing cholangitis.
    3140. Schizophrenia.
    PharmGKBi PA164742621.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG282899.
    HOVERGENi HBG003854.
    KOi K15603.
    OrthoDBi EOG72G16Q.
    PhylomeDBi P15884.
    TreeFami TF321672.

    Enzyme and pathway databases

    Reactomei REACT_21402. CDO in myogenesis.
    SignaLinki P15884.

    Miscellaneous databases

    ChiTaRSi TCF4. human.
    EvolutionaryTracei P15884.
    GeneWikii TCF4.
    GenomeRNAii 6925.
    NextBioi 27093.
    PROi P15884.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P15884.
    Bgeei P15884.
    CleanExi HS_TCF4.
    Genevestigatori P15884.

    Family and domain databases

    Gene3Di 4.10.280.10. 1 hit.
    InterProi IPR011598. bHLH_dom.
    [Graphical view ]
    Pfami PF00010. HLH. 1 hit.
    [Graphical view ]
    SMARTi SM00353. HLH. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47459. SSF47459. 1 hit.
    PROSITEi PS50888. BHLH. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Helix-loop-helix transcriptional activators bind to a sequence in glucocorticoid response elements of retrovirus enhancers."
      Corneliussen B., Thornell A., Hallberg B., Grundstroem T.
      J. Virol. 65:6084-6093(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SEF2-1A; SEF2-1B AND SEF2-1D), ALTERNATIVE SPLICING (ISOFORM SEF2-1C).
      Tissue: Thymocyte and Thymus.
    2. "Functional diversity of human basic helix-loop-helix transcription factor TCF4 isoforms generated by alternative 5' exon usage and splicing."
      Sepp M., Kannike K., Eesmaa A., Urb M., Timmusk T.
      PLoS ONE 6:E22138-E22138(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A-; B-DELTA; B+DELTA; C-; C-DELTA; D-; E-; F-; G-; H-; I-; SEF2-1A; SEF2-1B AND SEF2-1D), ALTERNATIVE SPLICING.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SEF2-1A; C-; D-; F-; 11 AND 13).
      Tissue: Brain, Hippocampus, Spleen and Teratocarcinoma.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SEF2-1B AND SEF2-1D).
    7. "MDSDCE06_MDS Homo sapiens cDNA clone MDSDCE06 5',mRNA sequence."
      Gu J., Zhao M., Huang Q., Xu X., Li Y., Peng Y., Song H., Xiao H., Gu Y., Li N., Qian B., Liu F., Qu J., Gao X., Cheng Z., Xu Z., Zeng L., Xu S.
      , Gu W., Tu Y., Jia J., Fu G., Ren S., Zhong M., Lu G., Yang Y., Gao G., Zhang Q., Chen S., Han Z., Chen Z.
      Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-278 (ISOFORM SEF2-1A).
    8. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 25-48.
      Tissue: Skin fibroblast.
    9. "Sequence of the cDNA encoding ITF-2, a positive-acting transcription factor."
      Henthorn P., McCarrick-Walmsley R., Kadesch T.
      Nucleic Acids Res. 18:678-678(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 46-667 (ISOFORM SEF2-1B).
    10. "Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif."
      Henthorn P., Kiledjian M., Kadesch T.
      Science 247:467-470(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISCUSSION OF SEQUENCE.
    11. "Nine-amino-acid transactivation domain: establishment and prediction utilities."
      Piskacek S., Gregor M., Nemethova M., Grabner M., Kovarik P., Piskacek M.
      Genomics 89:756-768(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: DOMAIN.
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-515, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Functional analysis of TCF4 missense mutations that cause Pitt-Hopkins syndrome."
      Forrest M., Chapman R.M., Doyle A.M., Tinsley C.L., Waite A., Blake D.J.
      Hum. Mutat. 33:1676-1686(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, CHARACTERIZATION OF VARIANTS PTHS VAL-358; GLY-535; PRO-574; TRP-576 AND VAL-610.
    14. "Mutations in AGBL1 cause dominant late-onset Fuchs corneal dystrophy and alter protein-protein interaction with TCF4."
      Riazuddin S.A., Vasanth S., Katsanis N., Gottsch J.D.
      Am. J. Hum. Genet. 93:758-764(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH AGBL1.
    15. "Mutations in TCF4, encoding a class I basic helix-loop-helix transcription factor, are responsible for Pitt-Hopkins syndrome, a severe epileptic encephalopathy associated with autonomic dysfunction."
      Amiel J., Rio M., de Pontual L., Redon R., Malan V., Boddaert N., Plouin P., Carter N.P., Lyonnet S., Munnich A., Colleaux L.
      Am. J. Hum. Genet. 80:988-993(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS PTHS TRP-576 AND GLN-576.
    16. Cited for: VARIANT PTHS TRP-576.
    17. Cited for: VARIANTS PTHS VAL-358; PRO-574 AND HIS-578.
    18. Cited for: VARIANTS PTHS GLY-535; GLY-572; GLN-576 AND VAL-610, CHARACTERIZATION OF VARIANTS PTHS GLY-535; GLY-572; GLN-576 AND VAL-610.
    19. "Two percent of patients suspected of having Angelman syndrome have TCF4 mutations."
      Takano K., Lyons M., Moyes C., Jones J., Schwartz C.E.
      Clin. Genet. 78:282-288(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT PTHS PRO-578.
    20. Cited for: VARIANTS PTHS TRP-565; GLY-572; GLN-572; HIS-574; PRO-574; TRP-576; GLN-576; PRO-578; PRO-583 AND VAL-610.

    Entry informationi

    Entry nameiITF2_HUMAN
    AccessioniPrimary (citable) accession number: P15884
    Secondary accession number(s): B3KT62
    , B3KUC0, B4DT37, B4DUG3, B7Z5M6, B7Z6Y1, G0LNT9, G0LNU0, G0LNU1, G0LNU2, G0LNU4, G0LNU5, G0LNU8, G0LNU9, G0LNV0, G0LNV1, G0LNV2, H3BPQ1, Q08AP2, Q08AP3, Q15439, Q15440, Q15441
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 1, 1990
    Last sequence update: December 15, 1998
    Last modified: October 1, 2014
    This is version 158 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3