P15529 (MCP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 146.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Membrane cofactor protein Alternative name(s): TLX Trophoblast leukocyte common antigen CD_antigen=CD46 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 392 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens seem to exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46. Ref.29 Ref.41 |
| Subunit structure | Interacts with C3b and C4b. Binds to Measles virus H protein, to Human herpesvirus 6 GH protein and to human adenovirus B/D PIV/fiber protein, and acts as a receptor for these viruses. Binds to Streptococcus pyogenes M protein and to type IV pili from Neisseria, and may act as a receptor for these pathogenic bacteria. Ref.1 Ref.19 Ref.23 Ref.25 Ref.30 Ref.31 Ref.34 Ref.36 Ref.38 Ref.39 Ref.42 Ref.44 Ref.45 Ref.46 Ref.47 |
| Subcellular location | Cytoplasmic vesicle › secretory vesicle › acrosome inner membrane; Single-pass type I membrane protein. Note: Inner acrosomal membrane of spermatozoa. Internalized upon binding of Measles virus, Herpesvirus 6 or Neisseria gonorrhoeae, which results in an increased susceptibility of infected cells to complement-mediated injury. In cancer cells or cells infected by Neisseria, shedding leads to a soluble peptide. Ref.35 Ref.37 Ref.43 |
| Tissue specificity | Expressed by all cells except erythrocytes. |
| Domain | Sushi domains 1 and 2 are required for interaction with human adenovirus B PIV/FIBER protein and with Measles virus H protein. Sushi domains 2 and 3 are required for Herpesvirus 6 binding. Sushi domain 3 is required for Neisseria binding. Sushi domains 3 and 4 are required for interaction with Streptococcus pyogenes M protein and are the most important for interaction with C3b and C4b. |
| Post-translational modification | N-glycosylated on Asn-83; Asn-114 and Asn-273 in most tissues, but probably less N-glycosylated in testis. N-glycosylation on Asn-114 and Asn-273 is required for cytoprotective function. N-glycosylation on Asn-114 is required for Measles virus binding. N-glycosylation on Asn-273 is required for Neisseria binding. N-glycosylation is not required for human adenovirus binding. Ref.35 Ref.43 Extensively O-glycosylated in the Ser/Thr-rich domain. O-glycosylation is required for Neisseria binding but not for Measles virus or human adenovirus binding. Ref.35 Ref.43 In epithelial cells, isoforms B/D/F/H/J/L/3 are phosphorylated by YES1 in response to infection by Neisseria gonorrhoeae; which promotes infectivity. In T-cells, these isoforms may be phosphorylated by Lck. Ref.28 Ref.33 Ref.48 Ref.49 |
| Involvement in disease | Defects in CD46 are a cause of susceptibility to hemolytic uremic syndrome atypical type 2 (AHUS2) [MIM:612922]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Patients with CD46 mutations seem to have an overall better prognosis compared to patients carrying CFH mutations. Ref.40 Ref.51 Ref.52 Ref.53 Ref.55 |
| Sequence similarities | Contains 4 Sushi (CCP/SCR) domains. |
Ontologies
Alternative products
| This entry describes 16 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. The complete sequences of the isoforms are not known. Isoforms are classified as alpha (isoform C and isoform D), beta (isoform E and isoform F), gamma (isoform A and isoform B) and delta (isoform N). Isoforms gamma are preferentially expressed in EBV-B cells and leukemic cells. Isoforms alpha (66 kDa) and isoforms beta (56 kDa) are found in all tissues except sperm. Isoform delta is expressed in spermatozoa. The exon 9 is specifically deleted in some placentae isoforms. All tissues differentially splice exon 13. | ||||||
| Isoform A (identifier: P15529-1) Also known as: no del; ABC1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P15529-2) Also known as: del 13; ABC2; The sequence of this isoform differs from the canonical sequence as follows: 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-384 and Tyr-387. | ||||||
| Isoform C (identifier: P15529-11) Also known as: del 7; BC1; The sequence of this isoform differs from the canonical sequence as follows: 286-300: Missing. | ||||||
| Isoform D (identifier: P15529-3) Also known as: del 7-13; BC2; The sequence of this isoform differs from the canonical sequence as follows: 286-300: Missing. 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-369 and Tyr-372. | ||||||
| Isoform E (identifier: P15529-12) Also known as: del 7-8; C1; The sequence of this isoform differs from the canonical sequence as follows: 286-315: Missing. | ||||||
| Isoform F (identifier: P15529-4) Also known as: del 7-8-13; C2; The sequence of this isoform differs from the canonical sequence as follows: 286-315: Missing. 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-354 and Tyr-357. | ||||||
| Isoform G (identifier: P15529-13) Also known as: del 9; The sequence of this isoform differs from the canonical sequence as follows: 316-329: Missing. | ||||||
| Isoform H (identifier: P15529-5) Also known as: del 9-13; The sequence of this isoform differs from the canonical sequence as follows: 316-329: Missing. 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-370 and Tyr-373. | ||||||
| Isoform I (identifier: P15529-14) Also known as: del 7-9; The sequence of this isoform differs from the canonical sequence as follows: 286-300: Missing. 316-329: Missing. | ||||||
| Isoform J (identifier: P15529-6) Also known as: del 7-9-13; The sequence of this isoform differs from the canonical sequence as follows: 286-300: Missing. 316-329: Missing. 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-355 and Tyr-358. | ||||||
| Isoform K (identifier: P15529-15) Also known as: del 7-8-9; The sequence of this isoform differs from the canonical sequence as follows: 286-329: Missing. | ||||||
| Isoform L (identifier: P15529-7) Also known as: del 7-8-9-13; The sequence of this isoform differs from the canonical sequence as follows: 286-329: Missing. 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-340 and Tyr-343. | ||||||
| Isoform M (identifier: P15529-8) Also known as: del 7-12a-13; The sequence of this isoform differs from the canonical sequence as follows: 286-300: Missing. 355-367: Missing. 368-392: YLQRRKKKGTYLTDETHREVKFTSL → GKQMVELNMPLTRLNQPLQQSREAE | ||||||
| Isoform N (identifier: P15529-9) Also known as: del 7-8-12-13; The sequence of this isoform differs from the canonical sequence as follows: 286-315: Missing. 355-392: VVGVAVICVVPYRYLQRRKKKGTYLTDETHREVKFTSL → GKQMVELNMPLTRLNQPLQQSREAE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: P15529-10) The sequence of this isoform differs from the canonical sequence as follows: 301-305: Missing. | ||||||
| Isoform 3 (identifier: P15529-16) The sequence of this isoform differs from the canonical sequence as follows: 33-33: D → G 34-96: Missing. 377-392: TYLTDETHREVKFTSL → KADGGAEYATYQTKSTTPAEQRG | ||||||
| Note: Phosphorylated on Tyr-321 and Tyr-324. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 34 | 34 | Ref.1 Ref.16 Ref.17 Ref.18 | ||||||||||||||||||||||||||||||
| Chain | 35 – 392 | 358 | Membrane cofactor protein | PRO_0000006008 | |||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||
| Topological domain | 35 – 343 | 309 | Extracellular Potential | ||||||||||||||||||||||||||||||
| Transmembrane | 344 – 366 | 23 | Helical; Potential | ||||||||||||||||||||||||||||||
| Topological domain | 367 – 392 | 26 | Cytoplasmic Potential | ||||||||||||||||||||||||||||||
| Domain | 35 – 96 | 62 | Sushi 1 | ||||||||||||||||||||||||||||||
| Domain | 97 – 159 | 63 | Sushi 2 | ||||||||||||||||||||||||||||||
| Domain | 160 – 225 | 66 | Sushi 3 | ||||||||||||||||||||||||||||||
| Domain | 226 – 285 | 60 | Sushi 4 | ||||||||||||||||||||||||||||||
| Compositional bias | 302 – 326 | 25 | Ser/Thr-rich | ||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||
| Glycosylation | 83 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||
| Glycosylation | 114 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||
| Glycosylation | 163 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 273 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||
| Glycosylation | 290 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 291 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 292 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 298 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 300 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 302 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 303 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 304 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 305 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 306 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 307 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 309 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 312 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 313 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 315 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 320 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Glycosylation | 326 | 1 | O-linked (GalNAc...) Potential | ||||||||||||||||||||||||||||||
| Disulfide bond | 35 ↔ 80 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 64 ↔ 94 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 99 ↔ 141 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 127 ↔ 157 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 162 ↔ 210 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 191 ↔ 223 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 228 ↔ 270 | By similarity | |||||||||||||||||||||||||||||||
| Disulfide bond | 256 ↔ 283 | By similarity | |||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 33 | 1 | D → G in isoform 3. | VSP_019005 | |||||||||||||||||||||||||||||
| Alternative sequence | 34 – 96 | 63 | Missing in isoform 3. | VSP_019006 | |||||||||||||||||||||||||||||
| Alternative sequence | 286 – 329 | 44 | Missing in isoform K and isoform L. | VSP_009176 | |||||||||||||||||||||||||||||
| Alternative sequence | 286 – 315 | 30 | Missing in isoform E, isoform F and isoform N. | VSP_009175 | |||||||||||||||||||||||||||||
| Alternative sequence | 286 – 300 | 15 | Missing in isoform C, isoform D, isoform I, isoform J and isoform M. | VSP_009174 | |||||||||||||||||||||||||||||
| Alternative sequence | 301 – 305 | 5 | Missing in isoform 2. | VSP_001201 | |||||||||||||||||||||||||||||
| Alternative sequence | 316 – 329 | 14 | Missing in isoform G, isoform H, isoform I and isoform J. | VSP_009177 | |||||||||||||||||||||||||||||
| Alternative sequence | 355 – 392 | 38 | VVGVA…KFTSL → GKQMVELNMPLTRLNQPLQQ SREAE in isoform N. | VSP_009178 | |||||||||||||||||||||||||||||
| Alternative sequence | 355 – 367 | 13 | Missing in isoform M. | VSP_001202 | |||||||||||||||||||||||||||||
| Alternative sequence | 368 – 392 | 25 | YLQRR…KFTSL → GKQMVELNMPLTRLNQPLQQ SREAE in isoform M. | VSP_001203 | |||||||||||||||||||||||||||||
| Alternative sequence | 377 – 392 | 16 | TYLTD…KFTSL → KADGGAEYATYQTKSTTPAE QRG in isoform B, isoform D, isoform F, isoform H, isoform J, isoform L and isoform 3. | VSP_001204 | |||||||||||||||||||||||||||||
| Natural variant | 13 | 1 | S → F. Ref.9 Ref.14 | VAR_026567 | |||||||||||||||||||||||||||||
| Natural variant | 35 | 1 | C → Y in AHUS2. Ref.52 | VAR_063656 | |||||||||||||||||||||||||||||
| Natural variant | 59 | 1 | R → Q. Ref.14 | VAR_026568 | |||||||||||||||||||||||||||||
| Natural variant | 165 | 1 | P → S in AHUS2; reduced cell surface expression. Ref.53 | VAR_026569 | |||||||||||||||||||||||||||||
| Natural variant | 216 | 1 | W → C in AHUS2. Ref.55 | VAR_063657 | |||||||||||||||||||||||||||||
| Natural variant | 228 | 1 | C → Y in a colorectal cancer sample; somatic mutation. Ref.54 | VAR_035828 | |||||||||||||||||||||||||||||
| Natural variant | 231 | 1 | P → R in AHUS2. Ref.55 | VAR_063658 | |||||||||||||||||||||||||||||
| Natural variant | 240 | 1 | S → P in AHUS2; no change in cell surface expression but reduced activity. Ref.51 | VAR_026570 | |||||||||||||||||||||||||||||
| Natural variant | 266 | 1 | D → N. Ref.10 Corresponds to variant rs17006830 [ dbSNP | Ensembl ]. | VAR_022262 | |||||||||||||||||||||||||||||
| Natural variant | 271 – 272 | 2 | Missing in AHUS2; no cell surface expression. | VAR_026571 | |||||||||||||||||||||||||||||
| Natural variant | 324 | 1 | P → L. Ref.10 Corresponds to variant rs41317833 [ dbSNP | Ensembl ]. | VAR_022263 | |||||||||||||||||||||||||||||
| Natural variant | 353 | 1 | A → V. Ref.10 Ref.54 Corresponds to variant rs35366573 [ dbSNP | Ensembl ]. | VAR_022264 | |||||||||||||||||||||||||||||
| Natural variant | 355 | 1 | V → G. Ref.10 | VAR_022265 | |||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | N → Q: No effect on cytoprotective function. No effect on Neisseria binding. No effect on Measles virus binding. Ref.24 Ref.26 Ref.31 | ||||||||||||||||||||||||||||||
| Mutagenesis | 114 | 1 | N → Q: Strongly decreases cytoprotective function. Decreases Neisseria binding. Abolishes Measles virus binding. Ref.24 Ref.26 Ref.31 | ||||||||||||||||||||||||||||||
| Mutagenesis | 273 | 1 | N → Q: Strongly decreases cytoprotective function. Abolishes Neisseria binding. No effect on Measles virus binding. Ref.24 Ref.26 Ref.31 | ||||||||||||||||||||||||||||||
| Sequence conflict | 25 | 1 | V → A in CAE45719. Ref.8 | ||||||||||||||||||||||||||||||
| Sequence conflict | 108 | 1 | G → S in CAD97694. Ref.8 | ||||||||||||||||||||||||||||||
| Sequence conflict | 159 | 1 | K → S in CAD97694. Ref.8 | ||||||||||||||||||||||||||||||
| Sequence conflict | 162 | 1 | C → R in CAI45983. Ref.8 | ||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Beta strand | 42 – 48 | 7 | |||||||||||||||||||||||||||||||
| Beta strand | 59 – 64 | 6 | |||||||||||||||||||||||||||||||
| Beta strand | 68 – 70 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 72 – 74 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 84 – 86 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 94 – 96 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 112 – 115 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 121 – 124 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 133 – 135 | 3 | |||||||||||||||||||||||||||||||
| Beta strand | 137 – 144 | 8 | |||||||||||||||||||||||||||||||
| Beta strand | 147 – 149 | 3 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and chromosomal localization of human membrane cofactor protein (MCP). Evidence for inclusion in the multigene family of complement-regulatory proteins." Lublin D.M., Liszewski M.K., Post T.W., Arce M.A., le Beau M.M., Rebentisch M.B., Lemons R.S., Seya T., Atkinson J.P. J. Exp. Med. 168:181-194(1988) [PubMed: 3260937] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), PROTEIN SEQUENCE OF 35-58, INTERACTION WITH C3B. |
| [2] | "Alternatively spliced RNAs encode several isoforms of CD46 (MCP), a regulator of complement activation." Purcell D.F., Russell S.M., Deacon N.J., Brown M.A., Hooker D.J., McKenzie I.F. Immunogenetics 33:335-344(1991) [PubMed: 2050389] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), ALTERNATIVE SPLICING. |
| [3] | "Membrane cofactor protein of the complement system: alternative splicing of serine/threonine/proline-rich exons and cytoplasmic tails produces multiple isoforms that correlate with protein phenotype." Post T.W., Liszewski M.K., Adams E.M., Tedja I., Miller E.A., Atkinson J.P. J. Exp. Med. 174:93-102(1991) [PubMed: 1711570] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B; C; D; E AND F). |
| [4] | "Characterization of a cDNA clone coding for human testis membrane cofactor protein (MCP, CD46)." Cervoni F., Fenichel P., Akhoundi C., Hsi B.L., Rossi B. Mol. Reprod. Dev. 34:107-113(1993) [PubMed: 8418811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM F). Tissue: Testis. |
| [5] | "Post-translational modification and intracellular localization of a splice product of CD46 cloned from human testis: role of the intracellular domains in O-glycosylation." Hara T., Suzuki Y., Nakazawa T., Nishimura H., Nagasawa S., Nishiguchi M., Matsumoto M., Hatanaka M., Kitamura M., Seya T. Immunology 93:546-555(1998) [PubMed: 9659228] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM N). Tissue: Testis. |
| [6] | "Molecular cloning of human CD46 (membrane cofactor protein) CDS from cancer cell lines in a retroviral vector system." Xue Z.T., Widegren B., Salford L. Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS D; F AND L). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D). Tissue: Teratocarcinoma. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS D AND E). Tissue: Fetal kidney, Liver and Salivary gland. |
| [9] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), VARIANT PHE-13. Tissue: Liver. |
| [10] | SeattleSNPs variation discovery resource Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ASN-266; LEU-324; VAL-353 AND GLY-355. |
| [11] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D). Tissue: Testis. |
| [14] | "Analysis of measles virus binding sites of the CD46 gene in patients with subacute sclerosing panencephalitis." Kusuhara K., Sasaki Y., Nakao F., Ihara K., Hattori H., Yamashita S., Nihei K., Koide N., Aiba H., Takeshita K., Hara T. J. Infect. Dis. 181:1447-1449(2000) [PubMed: 10751138] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-158, VARIANTS PHE-13 AND GLN-59. |
| [15] | "Characterization of the promoter region of the membrane cofactor protein (CD46) gene of the human complement system and comparison to a membrane cofactor protein-like genetic element." Cui W., Hourcade D., Post T.W., Greenlund A.C., Atkinson J.P., Kumar V. J. Immunol. 151:4137-4146(1993) [PubMed: 7691939] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-34. |
| [16] | "Homology of an acrosome-reacted sperm-specific antigen to CD46." Okabe M., Ying X., Nagira M., Ikawa M., Kohama Y., Mimura T., Tanaka K. J. Pharmacobio-Dyn. 15:455-459(1992) [PubMed: 1479546] [Abstract] Cited for: PROTEIN SEQUENCE OF 35-60. Tissue: Sperm. |
| [17] | "Human non-lineage antigen, CD46 (HuLy-m5): purification and partial sequencing demonstrates structural homology with complement-regulating glycoproteins." Purcell D.F., Deacon N.J., Andrew S.M., McKenzie I.F. Immunogenetics 31:21-28(1990) [PubMed: 2298462] [Abstract] Cited for: PROTEIN SEQUENCE OF 35-58. |
| [18] | "Human membrane cofactor protein (CD46) acts as a cellular receptor for measles virus." Naniche D., Varior-Krishnan G., Cervoni F., Wild T.F., Rossi B., Rabourdin-Combe C., Gerlier D. J. Virol. 67:6025-6032(1993) [PubMed: 8371352] [Abstract] Cited for: PROTEIN SEQUENCE OF 35-49, BINDING TO MEASLES VIRUS. |
| [19] | "Contribution of the repeating domains of membrane cofactor protein (CD46) of the complement system to ligand binding and cofactor activity." Adams E.M., Brown M.C., Nunge M., Krych M., Atkinson J.P. J. Immunol. 147:3005-3011(1991) [PubMed: 1717583] [Abstract] Cited for: INTERACTION WITH C3B AND C4B. |
| [20] | "Tissue-specific and allelic expression of the complement regulator CD46 is controlled by alternative splicing." Russell S.M., Sparrow R.L., McKenzie I.F.C., Purcell D.F.J. Eur. J. Immunol. 22:1513-1518(1992) [PubMed: 1601037] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [21] | "The human CD46 molecule is a receptor for measles virus (Edmonston strain)." Doerig R.E., Marcil A., Chopra A., Richardson C.D. Cell 75:295-305(1993) [PubMed: 8402913] [Abstract] Cited for: BINDING TO MEASLES VIRUS. |
| [22] | "Measles virus and C3 binding sites are distinct on membrane cofactor protein (CD46)." Manchester M., Valsamakis A., Kaufman R., Liszewski M.K., Alvarez J., Atkinson J.P., Lublin D.M., Oldstone M.B. Proc. Natl. Acad. Sci. U.S.A. 92:2303-2307(1995) [PubMed: 7534417] [Abstract] Cited for: BINDING TO MEASLES VIRUS. |
| [23] | "Membrane cofactor protein (CD46) is a keratinocyte receptor for the M protein of the group A streptococcus." Okada N., Liszewski M.K., Atkinson J.P., Caparon M. Proc. Natl. Acad. Sci. U.S.A. 92:2489-2493(1995) [PubMed: 7708671] [Abstract] Cited for: INTERACTION WITH STREPTOCOCCUS PYOGENES M PROTEIN. |
| [24] | "The N-glycan of the SCR 2 region is essential for membrane cofactor protein (CD46) to function as a measles virus receptor." Maisner A., Alvarez J., Liszewski M.K., Atkinson D.J., Atkinson J.P., Herrler G. J. Virol. 70:4973-4977(1996) [PubMed: 8764003] [Abstract] Cited for: MUTAGENESIS OF ASN-83; ASN-114 AND ASN-273. |
| [25] | "Membrane cofactor protein (MCP or CD46) is a cellular pilus receptor for pathogenic Neisseria." Kaellstroem H., Liszewski M.K., Atkinson J.P., Jonsson A.-B. Mol. Microbiol. 25:639-647(1997) [PubMed: 9379894] [Abstract] Cited for: INTERACTION WITH NEISSERIA TYPE IV PILI. |
| [26] | "Membrane cofactor protein: importance of N- and O-glycosylation for complement regulatory function." Liszewski M.K., Leung M.K., Atkinson J.P. J. Immunol. 161:3711-3718(1998) [PubMed: 9759896] [Abstract] Cited for: MUTAGENESIS OF ASN-83; ASN-114 AND ASN-273. |
| [27] | "CD46 is a cellular receptor for human herpesvirus 6." Santoro F., Kennedy P.E., Locatelli G., Malnati M.S., Berger E.A., Lusso P. Cell 99:817-827(1999) [PubMed: 10619434] [Abstract] Cited for: BINDING OF HUMAN HERPESVIRUS 6. |
| [28] | "Membrane cofactor protein (MCP; CD46): isoform-specific tyrosine phosphorylation." Wang G., Liszewski M.K., Chan A.C., Atkinson J.P. J. Immunol. 164:1839-1846(2000) [PubMed: 10657632] [Abstract] Cited for: PHOSPHORYLATION (ISOFORMS B/D/F/H/J/L/3). |
| [29] | "CD46, a new costimulatory molecule for T cells, that induces p120CBL and LAT phosphorylation." Astier A., Trescol-Biemont M.-C., Azocar O., Lamouille B., Rabourdin-Combe C. J. Immunol. 164:6091-6095(2000) [PubMed: 10843656] [Abstract] Cited for: FUNCTION. |
| [30] | "SLAM (CDw150) is a cellular receptor for measles virus." Tatsuo H., Ono N., Tanaka K., Yanagi Y. Nature 406:893-897(2000) [PubMed: 10972291] [Abstract] Cited for: INTERACTION WITH MEASLES VIRUS H PROTEIN. |
| [31] | "Attachment of Neisseria gonorrhoeae to the cellular pilus receptor CD46: identification of domains important for bacterial adherence." Kaellstroem H., Blackmer Gill D., Albiger B., Liszewski M.K., Atkinson J.P., Jonsson A.-B. Cell. Microbiol. 3:133-143(2001) [PubMed: 11260136] [Abstract] Cited for: INTERACTION WITH NEISSERIA TYPE IV PILI, MUTAGENESIS OF ASN-83; ASN-114 AND ASN-273. |
| [32] | "Human Herpesvirus 6 and Measles Virus employ distinct CD46 domains for receptor function." Greenstone H.L., Santoro F., Lusso P., Berger E.A. J. Biol. Chem. 277:39112-39118(2002) [PubMed: 12171934] [Abstract] Cited for: BINDING OF HUMAN HERPESVIRUS 6. |
| [33] | "CD46 is phosphorylated at tyrosine 354 upon infection of epithelial cells by Neisseria gonorrhoeae." Lee S.W., Bonnah R.A., Higashi D.L., Atkinson J.P., Milgram S.L., So M. J. Cell Biol. 156:951-957(2002) [PubMed: 11901164] [Abstract] Cited for: PHOSPHORYLATION (ISOFORMS B/D/F/H/J/L/3). |
| [34] | "Identification of the streptococcal M protein binding site on membrane cofactor protein (CD46)." Giannakis E., Jokiranta T.S., Ormsby R.J., Duthy T.G., Male D.A., Christiansen D., Fischetti V.A., Bagley C., Loveland B.E., Gordon D.L. J. Immunol. 168:4585-4592(2002) [PubMed: 11971006] [Abstract] Cited for: INTERACTION WITH STREPTOCOCCUS PYOGENES M PROTEIN. |
| [35] | "Characterization of human membrane cofactor protein (MCP; CD46) on spermatozoa." Riley R.C., Kemper C., Leung M., Atkinson J.P. Mol. Reprod. Dev. 62:534-546(2002) [PubMed: 12112588] [Abstract] Cited for: SUBCELLULAR LOCATION, GLYCOSYLATION. |
| [36] | "Interaction of glycoprotein H of human herpesvirus 6 with the cellular receptor CD46." Santoro F., Greenstone H.L., Insinga A., Liszewski M.K., Atkinson J.P., Lusso P., Berger E.A. J. Biol. Chem. 278:25964-25969(2003) [PubMed: 12724329] [Abstract] Cited for: INTERACTION WITH HUMAN HERPESVIRUS 6 GH PROTEIN. |
| [37] | "Down-regulation of CD46 by piliated Neisseria gonorrhoeae." Gill D.B., Koomey M., Cannon J.G., Atkinson J.P. J. Exp. Med. 198:1313-1322(2003) [PubMed: 14597734] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [38] | "Human herpesvirus 6 variant A glycoprotein H-glycoprotein L-glycoprotein Q complex associates with human CD46." Mori Y., Yang X., Akkapaiboon P., Okuno T., Yamanishi K. J. Virol. 77:4992-4999(2003) [PubMed: 12663806] [Abstract] Cited for: INTERACTION WITH HUMAN HERPESVIRUS 6 GH PROTEIN. |
| [39] | "Adenovirus type 11 uses CD46 as a cellular receptor." Segerman A., Atkinson J.P., Marttila M., Dennerquist V., Wadell G., Arnberg N. J. Virol. 77:9183-9191(2003) [PubMed: 12915534] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS B TYPE 11 PIV/FIBER PROTEIN. |
| [40] | "Familial haemolytic uraemic syndrome and an MCP mutation." Noris M., Brioschi S., Caprioli J., Todeschini M., Bresin E., Porrati F., Gamba S., Remuzzi G. Lancet 362:1542-1547(2003) [PubMed: 14615110] [Abstract] Cited for: DISEASE. |
| [41] | "Activation of human CD4+ cells with CD3 and CD46 induces a T-regulatory cell 1 phenotype." Kemper C., Chan A.C., Green J.M., Brett K.A., Murphy K.M., Atkinson J.P. Nature 421:388-392(2003) [PubMed: 12540904] [Abstract] Cited for: FUNCTION. |
| [42] | "CD46 is a cellular receptor for group B adenoviruses." Gaggar A., Shayakhmetov D.M., Lieber A. Nat. Med. 9:1408-1412(2003) [PubMed: 14566335] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS B PIV/FIBER PROTEIN, IDENTIFICATION BY MASS SPECTROMETRY. |
| [43] | "Complement inhibitor membrane cofactor protein (MCP; CD46) is constitutively shed from cancer cell membranes in vesicles and converted by a metalloproteinase to a functionally active soluble form." Hakulinen J., Junnikkala S., Sorsa T., Meri S. Eur. J. Immunol. 34:2620-2629(2004) [PubMed: 15307194] [Abstract] Cited for: GLYCOSYLATION, SUBCELLULAR LOCATION. |
| [44] | "Membrane cofactor protein is a receptor for adenoviruses associated with epidemic keratoconjunctivitis." Wu E., Trauger S.A., Pache L., Mullen T.-M., von Seggern D.J., Siuzdak G., Nemerow G.R. J. Virol. 78:3897-3905(2004) [PubMed: 15047806] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS D TYPE 37 PIV/FIBER PROTEIN, IDENTIFICATION BY MASS SPECTROMETRY. |
| [45] | "The human membrane cofactor CD46 is a receptor for species B adenovirus serotype 3." Sirena D., Lilienfeld B., Eisenhut M., Kaelin S., Boucke K., Beerli R.R., Vogt L., Ruedl C., Bachmann M.F., Greber U.F., Hemmi S. J. Virol. 78:4454-4462(2004) [PubMed: 15078926] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS B TYPE 3 PIV/FIBER PROTEIN. |
| [46] | "Localization of regions in CD46 that interact with adenovirus." Gaggar A., Shayakhmetov D.M., Liszewski M.K., Atkinson J.P., Lieber A. J. Virol. 79:7503-7513(2005) [PubMed: 15919905] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS B TYPE 35 PIV/FIBER PROTEIN. |
| [47] | "CD46 is a cellular receptor for all species B adenoviruses except types 3 and 7." Marttila M., Persson D., Gustafsson D., Liszewski M.K., Atkinson J.P., Wadell G., Arnberg N. J. Virol. 79:14429-14436(2005) [PubMed: 16254377] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS B PIV/FIBER PROTEIN. |
| [48] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION (ISOFORMS B/D/F/H/J/L/3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [49] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-340 AND TYR-343 (ISOFORM L), MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [50] | "Crystal structure of two CD46 domains reveals an extended measles virus-binding surface." Casasnovas J.M., Larvie M., Stehle T. EMBO J. 18:2911-2922(1999) [PubMed: 10357804] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.1 ANGSTROMS) OF 35-160. |
| [51] | "Mutations in human complement regulator, membrane cofactor protein (CD46), predispose to development of familial hemolytic uremic syndrome." Richards A., Kemp E.J., Liszewski M.K., Goodship J.A., Lampe A.K., Decorte R., Muesluemanoglu M.H., Kavukcu S., Filler G., Pirson Y., Wen L.S., Atkinson J.P., Goodship T.H.J. Proc. Natl. Acad. Sci. U.S.A. 100:12966-12971(2003) [PubMed: 14566051] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS AHUS2 PRO-240 AND 271-ASP-SER-272 DEL. |
| [52] | "Genetics of HUS: the impact of MCP, CFH, and IF mutations on clinical presentation, response to treatment, and outcome." The international registry of recurrent and familial HUS/TTP Caprioli J., Noris M., Brioschi S., Pianetti G., Castelletti F., Bettinaglio P., Mele C., Bresin E., Cassis L., Gamba S., Porrati F., Bucchioni S., Monteferrante G., Fang C.J., Liszewski M.K., Kavanagh D., Atkinson J.P., Remuzzi G. Blood 108:1267-1279(2006) [PubMed: 16621965] [Abstract] Cited for: VARIANT AHUS2 TYR-35. |
| [53] | "Insights into hemolytic uremic syndrome: segregation of three independent predisposition factors in a large, multiple affected pedigree." Esparza-Gordillo J., Jorge E.G., Garrido C.A., Carreras L., Lopez-Trascasa M., Sanchez-Corral P., de Cordoba S.R. Mol. Immunol. 43:1769-1775(2006) [PubMed: 16386793] [Abstract] Cited for: VARIANT AHUS2 SER-165. |
| [54] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] TYR-228 AND VAL-353. |
| [55] | "Mutations in alternative pathway complement proteins in American patients with atypical hemolytic uremic syndrome." Maga T.K., Nishimura C.J., Weaver A.E., Frees K.L., Smith R.J.H. Hum. Mutat. 31:E1445-E1460(2010) [PubMed: 20513133] [Abstract] Cited for: VARIANTS AHUS2 CYS-216 AND ARG-231. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y00651 mRNA. Translation: CAA68675.1. M58050 mRNA. Translation: AAA62833.1. X59405 mRNA. No translation available. X59406 mRNA. No translation available. X59407 mRNA. No translation available. X59408 mRNA. No translation available. X59409 mRNA. No translation available. X59410 mRNA. No translation available. S51940 mRNA. Translation: AAB24802.1. D84105 mRNA. Translation: BAA12224.1. EF076055 mRNA. Translation: ABK81635.1. EF076056 mRNA. Translation: ABK81636.1. EF076057 mRNA. Translation: ABK81637.1. EF076058 mRNA. Translation: ABK81638.1. AK291227 mRNA. Translation: BAF83916.1. BX537451 mRNA. Translation: CAD97694.1. BX640613 mRNA. Translation: CAE45719.1. BX649050 mRNA. Translation: CAI45983.1. AK222822 mRNA. Translation: BAD96542.1. AY916779 Genomic DNA. Translation: AAW82433.1. AL365178, AL035209 Genomic DNA. Translation: CAH73947.1. AL365178, AL035209 Genomic DNA. Translation: CAH73948.1. AL365178, AL035209 Genomic DNA. Translation: CAH73949.1. AL365178, AL035209 Genomic DNA. Translation: CAH73950.1. AL365178, AL035209 Genomic DNA. Translation: CAH73951.1. AL365178, AL035209 Genomic DNA. Translation: CAH73952.1. AL365178, AL035209 Genomic DNA. Translation: CAH73953.1. AL365178, AL035209 Genomic DNA. Translation: CAH73954.1. AL035209, AL365178 Genomic DNA. Translation: CAI18804.1. AL035209, AL365178 Genomic DNA. Translation: CAI18805.1. AL035209, AL365178 Genomic DNA. Translation: CAI18806.1. AL035209, AL365178 Genomic DNA. Translation: CAI18807.1. AL035209, AL365178 Genomic DNA. Translation: CAI18808.1. AL035209, AL365178 Genomic DNA. Translation: CAI18809.1. AL035209, AL365178 Genomic DNA. Translation: CAI18810.1. AL035209, AL365178 Genomic DNA. Translation: CAI18811.1. CH471100 Genomic DNA. Translation: EAW93465.1. CH471100 Genomic DNA. Translation: EAW93470.1. CH471100 Genomic DNA. Translation: EAW93476.1. BC030594 mRNA. Translation: AAH30594.1. AF209712 mRNA. Translation: AAF73844.1. AF209713 mRNA. Translation: AAF73845.1. AF209714 mRNA. Translation: AAF73846.1. S65879 Genomic DNA. Translation: AAD13968.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00012035. IPI00173903. IPI00219852. IPI00219853. IPI00332397. IPI00332399. IPI00332401. IPI00337661. IPI00374175. IPI00374176. IPI00374177. IPI00374178. IPI00398353. IPI00398354. IPI00456644. IPI00479283. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | G02913. I54479. I57998. S01896. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_002380.3. NM_002389.4. NP_722548.1. NM_153826.3. NP_758860.1. NM_172350.2. NP_758861.1. NM_172351.2. NP_758862.1. NM_172352.2. NP_758863.1. NM_172353.2. NP_758869.1. NM_172359.2. NP_758871.1. NM_172361.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.510402. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P15529. | ||||||||||||||||||||||||||||||||||||||||||
| SMR | P15529. Positions 35-286. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-41232N. | ||||||||||||||||||||||||||||||||||||||||||
| IntAct | P15529. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-222279. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | P15529. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P15529. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 41019474. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P15529. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000358170; ENSP00000350893; ENSG00000117335. ENST00000391914; ENSP00000375781; ENSG00000117335. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4179. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4179. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001hgc.1. human. uc001hgd.1. human. uc001hge.1. human. uc001hgf.1. human. uc001hgg.1. human. uc001hgh.1. human. uc001hgi.1. human. uc001hgj.1. human. uc001hgk.1. human. uc001hgl.1. human. uc001hgm.1. human. uc001hgn.1. human. uc001hgo.1. human. uc001hgp.1. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 4179. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01P207925. | ||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0001540. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6953. CD46. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010401. HPA016903. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 120920. gene+phenotype. 612922. phenotype. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P15529. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 93576. Atypical hemolytic uremic syndrome with MCP/CD46 anomaly. 244242. HELLP syndrome. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30700. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG15219. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG006335. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | PRPTYKP. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG418BP6. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P15529. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P15529. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P15529. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000117335. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR016060. Complement_control_module. IPR017341. M_CF_CD46. IPR000436. Sushi_SCR_CCP. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.10.70.10. Complement_control_module. 4 hits. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K04007. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00084. Sushi. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF037971. TLX_CD46. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00032. CCP. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF57535. Complement_control_module. 4 hits. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50923. SUSHI. 4 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 16458. | ||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P15529. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | MCP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P15529 Secondary accession number(s): A0T1T0 Q9UCJ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with