Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P15509 (CSF2R_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 156. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Short name=GM-CSF-R-alpha
Short name=GMCSFR-alpha
Short name=GMR-alpha
Alternative name(s):
CDw116
CD_antigen=CD116
Gene names
Name:CSF2RA
Synonyms:CSF2R, CSF2RY
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length400 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

Subunit structure

Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors. The signaling GM-CSF receptor complex is a dodecamer of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. Ref.14

Subcellular location

Cell membrane; Single-pass type I membrane protein.

Isoform 3: Secreted Probable.

Isoform 4: Secreted Probable.

Isoform 6: Secreted Probable.

Domain

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.

The box 1 motif is required for JAK interaction and/or activation.

Involvement in disease

Pulmonary surfactant metabolism dysfunction 4 (SMDP4) [MIM:300770]: A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.13 Ref.15

Miscellaneous

The gene coding for this protein is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes.

Sequence similarities

Belongs to the type I cytokine receptor family. Type 5 subfamily.

Contains 1 fibronectin type-III domain.

Sequence caution

The sequence AAA60962.1 differs from that shown. Reason:

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P15509-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P15509-2)

The sequence of this isoform differs from the canonical sequence as follows:
     376-400: IIWEEFTPEEGKGYREEVLTVKEIT → MGPQRHHRCGWNLYPTPGPSPGSGSSPRLGSESSL
Isoform 3 (identifier: P15509-3)

The sequence of this isoform differs from the canonical sequence as follows:
     318-333: DDGNLGSVYIYVLLIV → LGYSGCSRQFHRSKTN
     334-400: Missing.
Isoform 4 (identifier: P15509-4)

The sequence of this isoform differs from the canonical sequence as follows:
     271-286: INVSGDLENRYNFPSS → VVLTTGTSALCTFMCS
     287-400: Missing.
Isoform 5 (identifier: P15509-5)

The sequence of this isoform differs from the canonical sequence as follows:
     316-400: GSDDGNLGSV...EEVLTVKEIT → DHLGGIHPRG...NLYIIFYVFI
Isoform 6 (identifier: P15509-6)

The sequence of this isoform differs from the canonical sequence as follows:
     216-233: ERFNPPSNVTVRCNTTHC → GSLGYSGCSRQFHRSKTN
     234-400: Missing.
Isoform 7 (identifier: P15509-7)

Also known as: Alu-GMRalpha;

The sequence of this isoform differs from the canonical sequence as follows:
     315-315: F → FGSHSVTQAGVQWHNLGSLQPPSPRLKRFSCLRLP
Isoform 8 (identifier: P15509-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2222
Chain23 – 400378Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
PRO_0000010872

Regions

Topological domain23 – 320298Extracellular Potential
Transmembrane321 – 34626Helical; Potential
Topological domain347 – 40054Cytoplasmic Potential
Domain220 – 320101Fibronectin type-III
Motif306 – 3105WSXWS motif
Motif355 – 3639Box 1 motif

Amino acid modifications

Glycosylation461N-linked (GlcNAc...) Potential
Glycosylation541N-linked (GlcNAc...) Potential
Glycosylation991N-linked (GlcNAc...) Potential
Glycosylation1231N-linked (GlcNAc...) Potential
Glycosylation1351N-linked (GlcNAc...) Potential
Glycosylation1821N-linked (GlcNAc...) Potential
Glycosylation1951N-linked (GlcNAc...) Potential
Glycosylation2231N-linked (GlcNAc...) Potential
Glycosylation2291N-linked (GlcNAc...) Ref.14
Glycosylation2721N-linked (GlcNAc...) Potential
Glycosylation3051N-linked (GlcNAc...) Potential
Disulfide bond126 ↔ 136 By similarity
Disulfide bond165 ↔ 178 By similarity

Natural variations

Alternative sequence1 – 133133Missing in isoform 8.
VSP_044272
Alternative sequence216 – 23318ERFNP…NTTHC → GSLGYSGCSRQFHRSKTN in isoform 6.
VSP_001663
Alternative sequence234 – 400167Missing in isoform 6.
VSP_001664
Alternative sequence271 – 28616INVSG…NFPSS → VVLTTGTSALCTFMCS in isoform 4.
VSP_001665
Alternative sequence287 – 400114Missing in isoform 4.
VSP_001666
Alternative sequence3151F → FGSHSVTQAGVQWHNLGSLQ PPSPRLKRFSCLRLP in isoform 7.
VSP_043715
Alternative sequence316 – 40085GSDDG…VKEIT → DHLGGIHPRGRERLPRRGLD REGNYLRPRGCRNGMDISAS ATRGNCFLDDAVNLYIIFYV FI in isoform 5.
VSP_001667
Alternative sequence318 – 33316DDGNL…VLLIV → LGYSGCSRQFHRSKTN in isoform 3.
VSP_001668
Alternative sequence334 – 40067Missing in isoform 3.
VSP_001669
Alternative sequence376 – 40025IIWEE…VKEIT → MGPQRHHRCGWNLYPTPGPS PGSGSSPRLGSESSL in isoform 2.
VSP_001670
Natural variant1961G → R in SMDP4. Ref.15
VAR_058507

Secondary structure

............. 400
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 1, 1990. Version 1.
Checksum: D9025B981E41311D

FASTA40046,207
        10         20         30         40         50         60 
MLLLVTSLLL CELPHPAFLL IPEKSDLRTV APASSLNVRF DSRTMNLSWD CQENTTFSKC 

        70         80         90        100        110        120 
FLTDKKNRVV EPRLSNNECS CTFREICLHE GVTFEVHVNT SQRGFQQKLL YPNSGREGTA 

       130        140        150        160        170        180 
AQNFSCFIYN ADLMNCTWAR GPTAPRDVQY FLYIRNSKRR REIRCPYYIQ DSGTHVGCHL 

       190        200        210        220        230        240 
DNLSGLTSRN YFLVNGTSRE IGIQFFDSLL DTKKIERFNP PSNVTVRCNT THCLVRWKQP 

       250        260        270        280        290        300 
RTYQKLSYLD FQYQLDVHRK NTQPGTENLL INVSGDLENR YNFPSSEPRA KHSVKIRAAD 

       310        320        330        340        350        360 
VRILNWSSWS EAIEFGSDDG NLGSVYIYVL LIVGTLVCGI VLGFLFKRFL RIQRLFPPVP 

       370        380        390        400 
QIKDKLNDNH EVEDEIIWEE FTPEEGKGYR EEVLTVKEIT 

« Hide

Isoform 2 [UniParc].

Checksum: C95FD645760C19DB
Show »

FASTA41046,901
Isoform 3 [UniParc].

Checksum: 8F13C90D460D6255
Show »

FASTA33338,439
Isoform 4 [UniParc].

Checksum: 4222498F3A1F31F1
Show »

FASTA28632,915
Isoform 5 [UniParc].

Checksum: CAC52B3055225400
Show »

FASTA37743,545
Isoform 6 [UniParc].

Checksum: E73741ADEDD70478
Show »

FASTA23326,648
Isoform 7 (Alu-GMRalpha) [UniParc].

Checksum: 8190BD7AF28C93EC
Show »

FASTA43449,944
Isoform 8 [UniParc].

Checksum: FBF60C31AC0E0B3A
Show »

FASTA26731,101

References

« Hide 'large scale' references
[1]"Expression cloning of a receptor for human granulocyte-macrophage colony-stimulating factor."
Gearing D.P., King J.A., Gough N.M., Nicola N.A.
EMBO J. 8:3667-3676(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Placenta.
[2]"Structure of the gene encoding the alpha subunit of the human granulocyte-macrophage colony stimulating factor receptor. Implications for the evolution of the cytokine receptor superfamily."
Nakagawa Y., Kosugi H., Miyajima A., Arai K., Yokota T.
J. Biol. Chem. 269:10905-10912(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
[3]"A functional isoform of the human granulocyte/macrophage colony-stimulating factor receptor has an unusual cytoplasmic domain."
Crosier K.E., Wong G.G., Mathey-Prevot B., Nathan D.G., Sieff C.A.
Proc. Natl. Acad. Sci. U.S.A. 88:7744-7748(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[4]"Cloning of a potentially soluble receptor for human GM-CSF."
Ashworth A., Kraft A.
Nucleic Acids Res. 18:7178-7178(1990) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Placenta.
[5]"Identification and molecular cloning of a soluble human granulocyte-macrophage colony-stimulating factor receptor."
Raines M.A., Liu L., Quan S.G., Joe V., DiPersio J.F., Golde D.W.
Proc. Natl. Acad. Sci. U.S.A. 88:8203-8207(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[6]"Cloning and sequencing of the cDNAs encoding two alternative splicing-derived variants of the alpha subunit of the granulocyte-macrophage colony-stimulating factor receptor."
Hu X., Emanuel P.D., Zuckerman K.S.
Biochim. Biophys. Acta 1223:306-308(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5).
Tissue: Blood.
[7]"Cloning and sequencing of the cDNA variant with 397 bp missing for the GM-CSF receptor alpha subunit."
Hu X., Zuckerman K.S.
Submitted (MAR-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
[8]"Discovery and characterization of a novel splice variant of the GM-CSF receptor alpha subunit."
Pelley J.L., Nicholls C.D., Beattie T.L., Brown C.B.
Exp. Hematol. 35:1483-1494(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
[9]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8).
Tissue: Synovium and Uterus.
[10]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta and Uterus.
[12]"Arrangement and localization of the human GM-CSF receptor alpha chain gene CSF2RA within the X-Y pseudoautosomal region."
Rappold G., Willson T.A., Henke A., Gough N.M.
Genomics 14:455-461(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE OF 376-400.
[13]"Pulmonary alveolar proteinosis caused by deletion of the GM-CSFRalpha gene in the X chromosome pseudoautosomal region 1."
Martinez-Moczygemba M., Doan M.L., Elidemir O., Fan L.L., Cheung S.W., Lei J.T., Moore J.P., Tavana G., Lewis L.R., Zhu Y., Muzny D.M., Gibbs R.A., Huston D.P.
J. Exp. Med. 205:2711-2716(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN SMDP4.
[14]"The structure of the GM-CSF receptor complex reveals a distinct mode of cytokine receptor activation."
Hansen G., Hercus T.R., McClure B.J., Stomski F.C., Dottore M., Powell J., Ramshaw H., Woodcock J.M., Xu Y., Guthridge M., McKinstry W.J., Lopez A.F., Parker M.W.
Cell 134:496-507(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (3.3 ANGSTROMS) OF 218-320 IN COMPLEX WITH CSF2RB AND CSF2, SUBUNIT, GLYCOSYLATION AT ASN-229.
[15]"Familial pulmonary alveolar proteinosis caused by mutations in CSF2RA."
Suzuki T., Sakagami T., Rubin B.K., Nogee L.M., Wood R.E., Zimmerman S.L., Smolarek T., Dishop M.K., Wert S.E., Whitsett J.A., Grabowski G., Carey B.C., Stevens C., van der Loo J.C., Trapnell B.C.
J. Exp. Med. 205:2703-2710(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT SMDP4 ARG-196.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X17648 mRNA. Translation: CAA35638.1.
D26628 Genomic DNA. Translation: BAA05656.1.
M64445 mRNA. Translation: AAA35908.1.
X54935 mRNA. Translation: CAA38697.1.
M73832 mRNA. Translation: AAA35909.1.
L29348 mRNA. Translation: AAA60961.1.
L29349 mRNA. Translation: AAA60962.1. Sequence problems.
U93096 mRNA. Translation: AAB51535.1.
DQ841258 mRNA. Translation: ABI32309.1.
AK293086 mRNA. Translation: BAF85775.1.
AK301395 mRNA. Translation: BAG62930.1.
BX649553 Genomic DNA. Translation: CAI95727.1.
BC002635 mRNA. Translation: AAH02635.1.
BC071835 mRNA. Translation: AAH71835.1.
CCDSCCDS35190.1. [P15509-5]
CCDS35191.1. [P15509-1]
CCDS35192.1. [P15509-3]
CCDS35193.1. [P15509-6]
CCDS55359.1. [P15509-7]
CCDS55360.1. [P15509-2]
CCDS55361.1. [P15509-8]
PIRS06945.
S13684.
S50039.
S50040.
RefSeqNP_001155001.1. NM_001161529.1. [P15509-1]
NP_001155002.1. NM_001161530.1. [P15509-7]
NP_001155003.1. NM_001161531.1. [P15509-2]
NP_001155004.1. NM_001161532.1. [P15509-8]
NP_006131.2. NM_006140.4. [P15509-1]
NP_758448.1. NM_172245.2. [P15509-1]
NP_758449.1. NM_172246.2. [P15509-5]
NP_758450.1. NM_172247.2. [P15509-3]
NP_758452.1. NM_172249.2. [P15509-6]
UniGeneHs.520937.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3CXEX-ray3.30C218-300[»]
ProteinModelPortalP15509.
SMRP15509. Positions 110-316.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107825. 4 interactions.
DIPDIP-635N.
IntActP15509. 2 interactions.
MINTMINT-7242386.
STRING9606.ENSP00000370935.

Chemistry

ChEMBLCHEMBL2364169.
DrugBankDB00020. Sargramostim.
GuidetoPHARMACOLOGY1707.

PTM databases

PhosphoSiteP15509.

Polymorphism databases

DMDM121509.

Proteomic databases

MaxQBP15509.
PaxDbP15509.
PRIDEP15509.

Protocols and materials databases

DNASU1438.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000355432; ENSP00000347606; ENSG00000198223. [P15509-5]
ENST00000355805; ENSP00000348058; ENSG00000198223. [P15509-6]
ENST00000361536; ENSP00000354836; ENSG00000198223. [P15509-3]
ENST00000381500; ENSP00000370911; ENSG00000198223. [P15509-3]
ENST00000381509; ENSP00000370920; ENSG00000198223. [P15509-2]
ENST00000381524; ENSP00000370935; ENSG00000198223. [P15509-1]
ENST00000381529; ENSP00000370940; ENSG00000198223. [P15509-1]
ENST00000417535; ENSP00000394227; ENSG00000198223. [P15509-7]
ENST00000432318; ENSP00000416437; ENSG00000198223. [P15509-1]
ENST00000501036; ENSP00000440491; ENSG00000198223. [P15509-8]
GeneID1438.
KEGGhsa:1438.
UCSCuc004cpn.2. human. [P15509-1]
uc010ncv.2. human. [P15509-7]
uc011mhb.1. human. [P15509-2]

Organism-specific databases

CTD1438.
GeneCardsGC0XP001347.
HGNCHGNC:2435. CSF2RA.
HPACAB016148.
MIM300770. phenotype.
306250. gene.
425000. gene.
neXtProtNX_P15509.
Orphanet264675. Congenital pulmonary alveolar proteinosis.
PharmGKBPA26938.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG74889.
HOGENOMHOG000004539.
HOVERGENHBG103561.
KOK05066.
OMANTTYLEC.
OrthoDBEOG73BVCJ.
PhylomeDBP15509.
TreeFamTF331549.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.
SignaLinkP15509.

Gene expression databases

ArrayExpressP15509.
BgeeP15509.
CleanExHS_CSF2RA.
GenevestigatorP15509.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015321. IL-6_rcpt_alpha-bd.
IPR003532. Short_hematopoietin_rcpt_2_CS.
[Graphical view]
PfamPF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SMARTSM00060. FN3. 1 hit.
[Graphical view]
SUPFAMSSF49265. SSF49265. 2 hits.
PROSITEPS50853. FN3. 1 hit.
PS01356. HEMATOPO_REC_S_F2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP15509.
GenomeRNAi1438.
NextBio35534741.
PROP15509.
SOURCESearch...

Entry information

Entry nameCSF2R_HUMAN
AccessionPrimary (citable) accession number: P15509
Secondary accession number(s): A7J003 expand/collapse secondary AC list , A8KAM1, B4DW68, J3JS76, J3JS77, O00207, Q14429, Q14430, Q14431, Q16564
Entry history
Integrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: April 1, 1990
Last modified: July 9, 2014
This is version 156 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries