Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

Gene

CSF2RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

BioCyciZFISH:G66-31531-MONOMER.
ReactomeiR-HSA-114604. GPVI-mediated activation cascade.
R-HSA-392451. G beta:gamma signalling through PI3Kgamma.
R-HSA-512988. Interleukin-3, 5 and GM-CSF signaling.
R-HSA-5673001. RAF/MAP kinase cascade.
R-HSA-5683826. Surfactant metabolism.
R-HSA-5688849. Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5).
R-HSA-5688890. Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4).
R-HSA-912526. Interleukin receptor SHC signaling.
SignaLinkiP15509.
SIGNORiP15509.

Names & Taxonomyi

Protein namesi
Recommended name:
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
Short name:
GM-CSF-R-alpha
Short name:
GMCSFR-alpha
Short name:
GMR-alpha
Alternative name(s):
CDw116
CD_antigen: CD116
Gene namesi
Name:CSF2RA
Synonyms:CSF2R, CSF2RY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:2435. CSF2RA.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini23 – 320ExtracellularSequence analysisAdd BLAST298
Transmembranei321 – 346HelicalSequence analysisAdd BLAST26
Topological domaini347 – 400CytoplasmicSequence analysisAdd BLAST54

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: ProtInc
  • intracellular Source: GOC
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Pulmonary surfactant metabolism dysfunction 4 (SMDP4)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress.
See also OMIM:300770
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_058507196G → R in SMDP4. 1 PublicationCorresponds to variant rs137852353dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi1438.
MalaCardsiCSF2RA.
MIMi300770. phenotype.
OpenTargetsiENSG00000198223.
Orphaneti264675. Congenital pulmonary alveolar proteinosis.
PharmGKBiPA26938.

Chemistry databases

ChEMBLiCHEMBL2364169.
DrugBankiDB00020. Sargramostim.
GuidetoPHARMACOLOGYi1707.

Polymorphism and mutation databases

BioMutaiCSF2RA.
DMDMi121509.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Add BLAST22
ChainiPRO_000001087223 – 400Granulocyte-macrophage colony-stimulating factor receptor subunit alphaAdd BLAST378

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi46N-linked (GlcNAc...)Sequence analysis1
Glycosylationi54N-linked (GlcNAc...)Sequence analysis1
Glycosylationi99N-linked (GlcNAc...)Sequence analysis1
Glycosylationi123N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi126 ↔ 136By similarity
Glycosylationi135N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi165 ↔ 178By similarity
Glycosylationi182N-linked (GlcNAc...)Sequence analysis1
Glycosylationi195N-linked (GlcNAc...)Sequence analysis1
Glycosylationi223N-linked (GlcNAc...)Sequence analysis1
Glycosylationi229N-linked (GlcNAc...)1 Publication1
Glycosylationi272N-linked (GlcNAc...)Sequence analysis1
Glycosylationi305N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP15509.
PeptideAtlasiP15509.
PRIDEiP15509.

PTM databases

iPTMnetiP15509.
PhosphoSitePlusiP15509.

Expressioni

Gene expression databases

BgeeiENSG00000198223.
CleanExiHS_CSF2RA.
ExpressionAtlasiP15509. baseline and differential.
GenevisibleiP15509. HS.

Organism-specific databases

HPAiCAB016148.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors. The signaling GM-CSF receptor complex is a dodecamer of two head-to-head hexamers of two alpha, two beta, and two ligand subunits.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FATE1Q969F03EBI-1763264,EBI-743099

Protein-protein interaction databases

BioGridi107825. 6 interactors.
DIPiDIP-635N.
IntActiP15509. 5 interactors.
MINTiMINT-7242386.

Structurei

Secondary structure

1400
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi42 – 44Combined sources3
Beta strandi46 – 48Combined sources3
Beta strandi59 – 67Combined sources9
Beta strandi69 – 72Combined sources4
Beta strandi80 – 82Combined sources3
Beta strandi89 – 97Combined sources9
Beta strandi122 – 129Combined sources8
Turni130 – 132Combined sources3
Beta strandi133 – 139Combined sources7
Beta strandi149 – 155Combined sources7
Beta strandi166 – 181Combined sources16
Beta strandi188 – 197Combined sources10
Beta strandi199 – 201Combined sources3
Beta strandi206 – 211Combined sources6
Helixi212 – 215Combined sources4
Beta strandi222 – 227Combined sources6
Beta strandi233 – 238Combined sources6
Helixi248 – 250Combined sources3
Beta strandi251 – 259Combined sources9
Beta strandi260 – 262Combined sources3
Beta strandi268 – 274Combined sources7
Beta strandi280 – 283Combined sources4
Beta strandi292 – 300Combined sources9
Turni301 – 303Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NKQX-ray3.30C113-400[»]
4RS1X-ray2.68B35-315[»]
ProteinModelPortaliP15509.
SMRiP15509.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP15509.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini220 – 320Fibronectin type-IIIPROSITE-ProRule annotationAdd BLAST101

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi306 – 310WSXWS motif5
Motifi355 – 363Box 1 motif9

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

Sequence similaritiesi

Contains 1 fibronectin type-III domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00520000055993.
HOGENOMiHOG000004539.
HOVERGENiHBG103561.
InParanoidiP15509.
KOiK05066.
OMAiIERFNPP.
OrthoDBiEOG091G0935.
PhylomeDBiP15509.
TreeFamiTF331549.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR003532. Short_hematopoietin_rcpt_2_CS.
IPR015321. TypeI_recpt_CBD.
[Graphical view]
PfamiPF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 1 hit.
PS01356. HEMATOPO_REC_S_F2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P15509-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLLVTSLLL CELPHPAFLL IPEKSDLRTV APASSLNVRF DSRTMNLSWD
60 70 80 90 100
CQENTTFSKC FLTDKKNRVV EPRLSNNECS CTFREICLHE GVTFEVHVNT
110 120 130 140 150
SQRGFQQKLL YPNSGREGTA AQNFSCFIYN ADLMNCTWAR GPTAPRDVQY
160 170 180 190 200
FLYIRNSKRR REIRCPYYIQ DSGTHVGCHL DNLSGLTSRN YFLVNGTSRE
210 220 230 240 250
IGIQFFDSLL DTKKIERFNP PSNVTVRCNT THCLVRWKQP RTYQKLSYLD
260 270 280 290 300
FQYQLDVHRK NTQPGTENLL INVSGDLENR YNFPSSEPRA KHSVKIRAAD
310 320 330 340 350
VRILNWSSWS EAIEFGSDDG NLGSVYIYVL LIVGTLVCGI VLGFLFKRFL
360 370 380 390 400
RIQRLFPPVP QIKDKLNDNH EVEDEIIWEE FTPEEGKGYR EEVLTVKEIT
Length:400
Mass (Da):46,207
Last modified:April 1, 1990 - v1
Checksum:iD9025B981E41311D
GO
Isoform 2 (identifier: P15509-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-400: IIWEEFTPEEGKGYREEVLTVKEIT → MGPQRHHRCGWNLYPTPGPSPGSGSSPRLGSESSL

Show »
Length:410
Mass (Da):46,901
Checksum:iC95FD645760C19DB
GO
Isoform 3 (identifier: P15509-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     318-333: DDGNLGSVYIYVLLIV → LGYSGCSRQFHRSKTN
     334-400: Missing.

Show »
Length:333
Mass (Da):38,439
Checksum:i8F13C90D460D6255
GO
Isoform 4 (identifier: P15509-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-286: INVSGDLENRYNFPSS → VVLTTGTSALCTFMCS
     287-400: Missing.

Show »
Length:286
Mass (Da):32,915
Checksum:i4222498F3A1F31F1
GO
Isoform 5 (identifier: P15509-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     316-400: GSDDGNLGSV...EEVLTVKEIT → DHLGGIHPRG...NLYIIFYVFI

Show »
Length:377
Mass (Da):43,545
Checksum:iCAC52B3055225400
GO
Isoform 6 (identifier: P15509-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-233: ERFNPPSNVTVRCNTTHC → GSLGYSGCSRQFHRSKTN
     234-400: Missing.

Show »
Length:233
Mass (Da):26,648
Checksum:iE73741ADEDD70478
GO
Isoform 7 (identifier: P15509-7) [UniParc]FASTAAdd to basket
Also known as: Alu-GMRalpha

The sequence of this isoform differs from the canonical sequence as follows:
     315-315: F → FGSHSVTQAGVQWHNLGSLQPPSPRLKRFSCLRLP

Show »
Length:434
Mass (Da):49,944
Checksum:i8190BD7AF28C93EC
GO
Isoform 8 (identifier: P15509-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.

Show »
Length:267
Mass (Da):31,101
Checksum:iFBF60C31AC0E0B3A
GO

Sequence cautioni

The sequence AAA60962 differs from that shown.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_058507196G → R in SMDP4. 1 PublicationCorresponds to variant rs137852353dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0442721 – 133Missing in isoform 8. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_001663216 – 233ERFNP…NTTHC → GSLGYSGCSRQFHRSKTN in isoform 6. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_001664234 – 400Missing in isoform 6. 1 PublicationAdd BLAST167
Alternative sequenceiVSP_001665271 – 286INVSG…NFPSS → VVLTTGTSALCTFMCS in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_001666287 – 400Missing in isoform 4. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_043715315F → FGSHSVTQAGVQWHNLGSLQ PPSPRLKRFSCLRLP in isoform 7. 1 Publication1
Alternative sequenceiVSP_001667316 – 400GSDDG…VKEIT → DHLGGIHPRGRERLPRRGLD REGNYLRPRGCRNGMDISAS ATRGNCFLDDAVNLYIIFYV FI in isoform 5. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_001668318 – 333DDGNL…VLLIV → LGYSGCSRQFHRSKTN in isoform 3. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_001669334 – 400Missing in isoform 3. 2 PublicationsAdd BLAST67
Alternative sequenceiVSP_001670376 – 400IIWEE…VKEIT → MGPQRHHRCGWNLYPTPGPS PGSGSSPRLGSESSL in isoform 2. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17648 mRNA. Translation: CAA35638.1.
D26628 Genomic DNA. Translation: BAA05656.1.
M64445 mRNA. Translation: AAA35908.1.
X54935 mRNA. Translation: CAA38697.1.
M73832 mRNA. Translation: AAA35909.1.
L29348 mRNA. Translation: AAA60961.1.
L29349 mRNA. Translation: AAA60962.1. Sequence problems.
U93096 mRNA. Translation: AAB51535.1.
DQ841258 mRNA. Translation: ABI32309.1.
AK293086 mRNA. Translation: BAF85775.1.
AK301395 mRNA. Translation: BAG62930.1.
BX649553 Genomic DNA. Translation: CAI95727.1.
BC002635 mRNA. Translation: AAH02635.1.
BC071835 mRNA. Translation: AAH71835.1.
CCDSiCCDS35190.1. [P15509-5]
CCDS35191.1. [P15509-1]
CCDS35192.1. [P15509-3]
CCDS35193.1. [P15509-6]
CCDS55359.1. [P15509-7]
CCDS55360.1. [P15509-2]
CCDS55361.1. [P15509-8]
PIRiS06945.
S13684.
S50039.
S50040.
RefSeqiNP_001155001.1. NM_001161529.1. [P15509-1]
NP_001155002.1. NM_001161530.1. [P15509-7]
NP_001155003.1. NM_001161531.1. [P15509-2]
NP_001155004.1. NM_001161532.1. [P15509-8]
NP_006131.2. NM_006140.4. [P15509-1]
NP_758448.1. NM_172245.2. [P15509-1]
NP_758449.1. NM_172246.2. [P15509-5]
NP_758450.1. NM_172247.2. [P15509-3]
NP_758452.1. NM_172249.2. [P15509-6]
XP_011543920.1. XM_011545618.2. [P15509-2]
XP_011543921.1. XM_011545619.1. [P15509-1]
XP_011543928.1. XM_011545626.1. [P15509-3]
XP_011543929.1. XM_011545627.2. [P15509-3]
XP_011543930.1. XM_011545628.2. [P15509-3]
XP_011544467.1. XM_011546165.2. [P15509-2]
XP_011544468.1. XM_011546166.1. [P15509-1]
XP_011544475.1. XM_011546173.1. [P15509-3]
XP_011544476.1. XM_011546174.2. [P15509-3]
XP_011544477.1. XM_011546175.2. [P15509-3]
XP_016884777.1. XM_017029288.1. [P15509-3]
XP_016885518.1. XM_017030029.1. [P15509-3]
UniGeneiHs.520937.

Genome annotation databases

EnsembliENST00000355432; ENSP00000347606; ENSG00000198223. [P15509-5]
ENST00000355805; ENSP00000348058; ENSG00000198223. [P15509-6]
ENST00000381500; ENSP00000370911; ENSG00000198223. [P15509-3]
ENST00000381509; ENSP00000370920; ENSG00000198223. [P15509-2]
ENST00000381524; ENSP00000370935; ENSG00000198223. [P15509-1]
ENST00000381529; ENSP00000370940; ENSG00000198223. [P15509-1]
ENST00000417535; ENSP00000394227; ENSG00000198223. [P15509-7]
ENST00000432318; ENSP00000416437; ENSG00000198223. [P15509-1]
ENST00000501036; ENSP00000440491; ENSG00000198223. [P15509-8]
GeneIDi1438.
KEGGihsa:1438.
UCSCiuc004cpn.3. human. [P15509-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17648 mRNA. Translation: CAA35638.1.
D26628 Genomic DNA. Translation: BAA05656.1.
M64445 mRNA. Translation: AAA35908.1.
X54935 mRNA. Translation: CAA38697.1.
M73832 mRNA. Translation: AAA35909.1.
L29348 mRNA. Translation: AAA60961.1.
L29349 mRNA. Translation: AAA60962.1. Sequence problems.
U93096 mRNA. Translation: AAB51535.1.
DQ841258 mRNA. Translation: ABI32309.1.
AK293086 mRNA. Translation: BAF85775.1.
AK301395 mRNA. Translation: BAG62930.1.
BX649553 Genomic DNA. Translation: CAI95727.1.
BC002635 mRNA. Translation: AAH02635.1.
BC071835 mRNA. Translation: AAH71835.1.
CCDSiCCDS35190.1. [P15509-5]
CCDS35191.1. [P15509-1]
CCDS35192.1. [P15509-3]
CCDS35193.1. [P15509-6]
CCDS55359.1. [P15509-7]
CCDS55360.1. [P15509-2]
CCDS55361.1. [P15509-8]
PIRiS06945.
S13684.
S50039.
S50040.
RefSeqiNP_001155001.1. NM_001161529.1. [P15509-1]
NP_001155002.1. NM_001161530.1. [P15509-7]
NP_001155003.1. NM_001161531.1. [P15509-2]
NP_001155004.1. NM_001161532.1. [P15509-8]
NP_006131.2. NM_006140.4. [P15509-1]
NP_758448.1. NM_172245.2. [P15509-1]
NP_758449.1. NM_172246.2. [P15509-5]
NP_758450.1. NM_172247.2. [P15509-3]
NP_758452.1. NM_172249.2. [P15509-6]
XP_011543920.1. XM_011545618.2. [P15509-2]
XP_011543921.1. XM_011545619.1. [P15509-1]
XP_011543928.1. XM_011545626.1. [P15509-3]
XP_011543929.1. XM_011545627.2. [P15509-3]
XP_011543930.1. XM_011545628.2. [P15509-3]
XP_011544467.1. XM_011546165.2. [P15509-2]
XP_011544468.1. XM_011546166.1. [P15509-1]
XP_011544475.1. XM_011546173.1. [P15509-3]
XP_011544476.1. XM_011546174.2. [P15509-3]
XP_011544477.1. XM_011546175.2. [P15509-3]
XP_016884777.1. XM_017029288.1. [P15509-3]
XP_016885518.1. XM_017030029.1. [P15509-3]
UniGeneiHs.520937.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4NKQX-ray3.30C113-400[»]
4RS1X-ray2.68B35-315[»]
ProteinModelPortaliP15509.
SMRiP15509.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107825. 6 interactors.
DIPiDIP-635N.
IntActiP15509. 5 interactors.
MINTiMINT-7242386.

Chemistry databases

ChEMBLiCHEMBL2364169.
DrugBankiDB00020. Sargramostim.
GuidetoPHARMACOLOGYi1707.

PTM databases

iPTMnetiP15509.
PhosphoSitePlusiP15509.

Polymorphism and mutation databases

BioMutaiCSF2RA.
DMDMi121509.

Proteomic databases

MaxQBiP15509.
PeptideAtlasiP15509.
PRIDEiP15509.

Protocols and materials databases

DNASUi1438.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355432; ENSP00000347606; ENSG00000198223. [P15509-5]
ENST00000355805; ENSP00000348058; ENSG00000198223. [P15509-6]
ENST00000381500; ENSP00000370911; ENSG00000198223. [P15509-3]
ENST00000381509; ENSP00000370920; ENSG00000198223. [P15509-2]
ENST00000381524; ENSP00000370935; ENSG00000198223. [P15509-1]
ENST00000381529; ENSP00000370940; ENSG00000198223. [P15509-1]
ENST00000417535; ENSP00000394227; ENSG00000198223. [P15509-7]
ENST00000432318; ENSP00000416437; ENSG00000198223. [P15509-1]
ENST00000501036; ENSP00000440491; ENSG00000198223. [P15509-8]
GeneIDi1438.
KEGGihsa:1438.
UCSCiuc004cpn.3. human. [P15509-1]

Organism-specific databases

CTDi1438.
DisGeNETi1438.
GeneCardsiCSF2RA.
HGNCiHGNC:2435. CSF2RA.
HPAiCAB016148.
MalaCardsiCSF2RA.
MIMi300770. phenotype.
306250. gene.
425000. gene.
neXtProtiNX_P15509.
OpenTargetsiENSG00000198223.
Orphaneti264675. Congenital pulmonary alveolar proteinosis.
PharmGKBiPA26938.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00520000055993.
HOGENOMiHOG000004539.
HOVERGENiHBG103561.
InParanoidiP15509.
KOiK05066.
OMAiIERFNPP.
OrthoDBiEOG091G0935.
PhylomeDBiP15509.
TreeFamiTF331549.

Enzyme and pathway databases

BioCyciZFISH:G66-31531-MONOMER.
ReactomeiR-HSA-114604. GPVI-mediated activation cascade.
R-HSA-392451. G beta:gamma signalling through PI3Kgamma.
R-HSA-512988. Interleukin-3, 5 and GM-CSF signaling.
R-HSA-5673001. RAF/MAP kinase cascade.
R-HSA-5683826. Surfactant metabolism.
R-HSA-5688849. Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5).
R-HSA-5688890. Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4).
R-HSA-912526. Interleukin receptor SHC signaling.
SignaLinkiP15509.
SIGNORiP15509.

Miscellaneous databases

EvolutionaryTraceiP15509.
GenomeRNAii1438.
PROiP15509.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198223.
CleanExiHS_CSF2RA.
ExpressionAtlasiP15509. baseline and differential.
GenevisibleiP15509. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR003532. Short_hematopoietin_rcpt_2_CS.
IPR015321. TypeI_recpt_CBD.
[Graphical view]
PfamiPF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 1 hit.
PS01356. HEMATOPO_REC_S_F2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCSF2R_HUMAN
AccessioniPrimary (citable) accession number: P15509
Secondary accession number(s): A7J003
, A8KAM1, B4DW68, J3JS76, J3JS77, O00207, Q14429, Q14430, Q14431, Q16564
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: April 1, 1990
Last modified: November 2, 2016
This is version 179 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The gene coding for this protein is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.