P15509 (CSF2R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha Short name=GM-CSF-R-alpha Short name=GMCSFR-alpha Short name=GMR-alpha Alternative name(s): CDw116 CD_antigen=CD116 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors. The signaling GM-CSF receptor complex is a dodecamer of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. Ref.12 |
| Subcellular location | |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding. The box 1 motif is required for JAK interaction and/or activation. |
| Involvement in disease | Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) [MIM:300770]. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. Ref.11 Ref.13 |
| Miscellaneous | The gene encoding for this protein is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. |
| Sequence similarities | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement. Source: ProtInc |
| Molecular function | cytokine receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P15509-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P15509-2) The sequence of this isoform differs from the canonical sequence as follows: 376-400: IIWEEFTPEEGKGYREEVLTVKEIT → MGPQRHHRCGWNLYPTPGPSPGSGSSPRLGSESSL | ||||||
| Isoform 3 (identifier: P15509-3) The sequence of this isoform differs from the canonical sequence as follows: 318-333: DDGNLGSVYIYVLLIV → LGYSGCSRQFHRSKTN 334-400: Missing. | ||||||
| Isoform 4 (identifier: P15509-4) The sequence of this isoform differs from the canonical sequence as follows: 271-286: INVSGDLENRYNFPSS → VVLTTGTSALCTFMCS 287-400: Missing. | ||||||
| Isoform 5 (identifier: P15509-5) The sequence of this isoform differs from the canonical sequence as follows: 316-400: GSDDGNLGSV...EEVLTVKEIT → DDHLGGIHPR...NLYIIFYVFI | ||||||
| Isoform 6 (identifier: P15509-6) The sequence of this isoform differs from the canonical sequence as follows: 216-233: ERFNPPSNVTVRCNTTHC → GSLGYSGCSRQFHRSKTN 234-400: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | |||||||||||||||||
| Chain | 23 – 400 | 378 | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha | PRO_0000010872 | |||||||||||||||
Regions | |||||||||||||||||||
| Topological domain | 23 – 320 | 298 | Extracellular Potential | ||||||||||||||||
| Transmembrane | 321 – 346 | 26 | Helical; Potential | ||||||||||||||||
| Topological domain | 347 – 400 | 54 | Cytoplasmic Potential | ||||||||||||||||
| Motif | 306 – 310 | 5 | WSXWS motif | ||||||||||||||||
| Motif | 355 – 363 | 9 | Box 1 motif | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Glycosylation | 46 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 54 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 99 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 123 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 135 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 182 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 195 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 223 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 229 | 1 | N-linked (GlcNAc...) Ref.12 | ||||||||||||||||
| Glycosylation | 272 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Glycosylation | 305 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||
| Disulfide bond | 126 ↔ 136 | By similarity | |||||||||||||||||
| Disulfide bond | 165 ↔ 178 | By similarity | |||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 216 – 233 | 18 | ERFNP…NTTHC → GSLGYSGCSRQFHRSKTN in isoform 6. | VSP_001663 | |||||||||||||||
| Alternative sequence | 234 – 400 | 167 | Missing in isoform 6. | VSP_001664 | |||||||||||||||
| Alternative sequence | 271 – 286 | 16 | INVSG…NFPSS → VVLTTGTSALCTFMCS in isoform 4. | VSP_001665 | |||||||||||||||
| Alternative sequence | 287 – 400 | 114 | Missing in isoform 4. | VSP_001666 | |||||||||||||||
| Alternative sequence | 316 – 400 | 85 | GSDDG…VKEIT → DDHLGGIHPRGRERLPRRGL DREGNYLRPRGCRNGMDISA SATRGNCFLDDAVNLYIIFY VFI in isoform 5. | VSP_001667 | |||||||||||||||
| Alternative sequence | 318 – 333 | 16 | DDGNL…VLLIV → LGYSGCSRQFHRSKTN in isoform 3. | VSP_001668 | |||||||||||||||
| Alternative sequence | 334 – 400 | 67 | Missing in isoform 3. | VSP_001669 | |||||||||||||||
| Alternative sequence | 376 – 400 | 25 | IIWEE…VKEIT → MGPQRHHRCGWNLYPTPGPS PGSGSSPRLGSESSL in isoform 2. | VSP_001670 | |||||||||||||||
| Natural variant | 196 | 1 | G → R in SMDP4. Ref.13 | VAR_058507 | |||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Beta strand | 226 – 228 | 3 | |||||||||||||||||
| Beta strand | 230 – 235 | 6 | |||||||||||||||||
| Beta strand | 249 – 254 | 6 | |||||||||||||||||
| Beta strand | 269 – 271 | 3 | |||||||||||||||||
| Beta strand | 295 – 303 | 9 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression cloning of a receptor for human granulocyte-macrophage colony-stimulating factor." Gearing D.P., King J.A., Gough N.M., Nicola N.A. EMBO J. 8:3667-3676(1989) [PubMed: 2555171] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Structure of the gene encoding the alpha subunit of the human granulocyte-macrophage colony stimulating factor receptor. Implications for the evolution of the cytokine receptor superfamily." Nakagawa Y., Kosugi H., Miyajima A., Arai K., Yokota T. J. Biol. Chem. 269:10905-10912(1994) [PubMed: 8144676] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [3] | "A functional isoform of the human granulocyte/macrophage colony-stimulating factor receptor has an unusual cytoplasmic domain." Crosier K.E., Wong G.G., Mathey-Prevot B., Nathan D.G., Sieff C.A. Proc. Natl. Acad. Sci. U.S.A. 88:7744-7748(1991) [PubMed: 1715577] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Cloning of a potentially soluble receptor for human GM-CSF." Ashworth A., Kraft A. Nucleic Acids Res. 18:7178-7178(1990) [PubMed: 2148207] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Placenta. |
| [5] | "Identification and molecular cloning of a soluble human granulocyte-macrophage colony-stimulating factor receptor." Raines M.A., Liu L., Quan S.G., Joe V., DiPersio J.F., Golde D.W. Proc. Natl. Acad. Sci. U.S.A. 88:8203-8207(1991) [PubMed: 1832774] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [6] | "Cloning and sequencing of the cDNAs encoding two alternative splicing-derived variants of the alpha subunit of the granulocyte-macrophage colony-stimulating factor receptor." Hu X., Emanuel P.D., Zuckerman K.S. Biochim. Biophys. Acta 1223:306-308(1994) [PubMed: 8086503] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5). Tissue: Blood. |
| [7] | "Cloning and sequencing of the cDNA variant with 397 bp missing for the GM-CSF receptor alpha subunit." Hu X., Zuckerman K.S. Submitted (MAR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta and Uterus. |
| [10] | "Arrangement and localization of the human GM-CSF receptor alpha chain gene CSF2RA within the X-Y pseudoautosomal region." Rappold G., Willson T.A., Henke A., Gough N.M. Genomics 14:455-461(1992) [PubMed: 1358805] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 376-400. |
| [11] | "Pulmonary alveolar proteinosis caused by deletion of the GM-CSFRalpha gene in the X chromosome pseudoautosomal region 1." Martinez-Moczygemba M., Doan M.L., Elidemir O., Fan L.L., Cheung S.W., Lei J.T., Moore J.P., Tavana G., Lewis L.R., Zhu Y., Muzny D.M., Gibbs R.A., Huston D.P. J. Exp. Med. 205:2711-2716(2008) [PubMed: 18955567] [Abstract] Cited for: INVOLVEMENT IN SMDP4. |
| [12] | "The structure of the GM-CSF receptor complex reveals a distinct mode of cytokine receptor activation." Hansen G., Hercus T.R., McClure B.J., Stomski F.C., Dottore M., Powell J., Ramshaw H., Woodcock J.M., Xu Y., Guthridge M., McKinstry W.J., Lopez A.F., Parker M.W. Cell 134:496-507(2008) [PubMed: 18692472] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.3 ANGSTROMS) OF 218-320 IN COMPLEX WITH CSF2RB AND CSF2, SUBUNIT, GLYCOSYLATION AT ASN-229. |
| [13] | "Familial pulmonary alveolar proteinosis caused by mutations in CSF2RA." Suzuki T., Sakagami T., Rubin B.K., Nogee L.M., Wood R.E., Zimmerman S.L., Smolarek T., Dishop M.K., Wert S.E., Whitsett J.A., Grabowski G., Carey B.C., Stevens C., van der Loo J.C., Trapnell B.C. J. Exp. Med. 205:2703-2710(2008) [PubMed: 18955570] [Abstract] Cited for: VARIANT SMDP4 ARG-196. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X17648 mRNA. Translation: CAA35638.1. D26628 Genomic DNA. Translation: BAA05656.1. M64445 mRNA. Translation: AAA35908.1. X54935 mRNA. Translation: CAA38697.1. M73832 mRNA. Translation: AAA35909.1. L29348 mRNA. Translation: AAA60961.1. L29349 mRNA. Translation: AAA60962.1. U93096 mRNA. Translation: AAB51535.1. AK293086 mRNA. Translation: BAF85775.1. BC002635 mRNA. Translation: AAH02635.1. BC071835 mRNA. Translation: AAH71835.1. | ||||||||||||
| IPI | IPI00012009. IPI00172409. IPI00219208. IPI00219210. IPI00219211. IPI00219212. | ||||||||||||
| PIR | S06945. S13684. S50039. S50040. | ||||||||||||
| RefSeq | NP_001155001.1. NM_001161529.1. NP_001155002.1. NM_001161530.1. NP_001155003.1. NM_001161531.1. NP_001155004.1. NM_001161532.1. NP_006131.2. NM_006140.4. NP_758448.1. NM_172245.2. NP_758449.1. NM_172246.2. NP_758450.1. NM_172247.2. NP_758452.1. NM_172249.2. | ||||||||||||
| UniGene | Hs.520937. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P15509. | ||||||||||||
| SMR | P15509. Positions 218-316. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-635N. | ||||||||||||
| IntAct | P15509. 2 interactions. | ||||||||||||
| MINT | MINT-7242386. | ||||||||||||
| STRING | P15509. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 121509. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P15509. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000381524; ENSP00000370935; ENSG00000198223. ENST00000381529; ENSP00000370940; ENSG00000198223. | ||||||||||||
| GeneID | 1438. | ||||||||||||
| KEGG | hsa:1438. | ||||||||||||
| UCSC | uc004cpn.1. human. uc004cpp.1. human. uc004cpq.1. human. uc004cpr.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1438. | ||||||||||||
| GeneCards | GC0XP001347. | ||||||||||||
| HGNC | HGNC:2435. CSF2RA. | ||||||||||||
| HPA | CAB016148. | ||||||||||||
| MIM | 300770. phenotype. 306250. gene. 425000. gene. | ||||||||||||
| neXtProt | NX_P15509. | ||||||||||||
| Orphanet | 264675. Congenital pulmonary alveolar proteinosis. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG15614. | ||||||||||||
| HOVERGEN | HBG103561. | ||||||||||||
| OrthoDB | EOG46Q6T8. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P15509. | ||||||||||||
| Bgee | P15509. | ||||||||||||
| CleanEx | HS_CSF2RA. | ||||||||||||
| Genevestigator | P15509. | ||||||||||||
| GermOnline | ENSG00000198223. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. IPR015321. IL6_recept-bd. IPR003532. Short_hematopoietin_rcpt_2_CS. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 2 hits. | ||||||||||||
| KO | K05066. | ||||||||||||
| Pfam | PF09240. IL6Ra-bind. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00060. FN3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF49265. FN_III-like. 2 hits. | ||||||||||||
| PROSITE | PS01356. HEMATOPO_REC_S_F2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| DrugBank | DB00020. Sargramostim. | ||||||||||||
| NextBio | 5875. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CSF2R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P15509 Secondary accession number(s): A8KAM1 Q16564 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with