Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peripherin

Gene

Prph

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Class-III neuronal intermediate filament protein.

GO - Molecular functioni

GO - Biological processi

  • intermediate filament cytoskeleton organization Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Peripherin
Gene namesi
Name:Prph
Synonyms:Prph1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:97774. Prph.

Subcellular locationi

GO - Cellular componenti

  • axon Source: MGI
  • C-fiber Source: MGI
  • extracellular exosome Source: MGI
  • intermediate filament Source: MGI
  • membrane Source: MGI
  • neurofilament Source: MGI
  • neuronal cell body Source: MGI
  • photoreceptor outer segment Source: MGI
  • photoreceptor outer segment membrane Source: MGI
  • type III intermediate filament Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Intermediate filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 475475PeripherinPRO_0000063780Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei18 – 181PhosphoserineBy similarity
Modified residuei20 – 201PhosphoserineBy similarity
Modified residuei21 – 211PhosphoserineBy similarity
Modified residuei23 – 231PhosphoserineBy similarity
Modified residuei24 – 241Nitrated tyrosineBy similarity
Modified residuei35 – 351PhosphoserineBy similarity
Modified residuei40 – 401PhosphoserineBy similarity
Modified residuei43 – 431PhosphoserineBy similarity
Modified residuei48 – 481PhosphoserineBy similarity
Modified residuei50 – 501PhosphoserineBy similarity
Modified residuei57 – 571PhosphoserineBy similarity
Modified residuei60 – 601PhosphoserineBy similarity
Modified residuei85 – 851PhosphoserineBy similarity
Modified residuei118 – 1181N6-acetyllysine; alternateBy similarity
Modified residuei118 – 1181N6-succinyllysine; alternateBy similarity
Modified residuei221 – 2211N6-acetyllysineBy similarity
Modified residuei224 – 2241PhosphoserineBy similarity
Modified residuei233 – 2331N6-acetyllysineBy similarity
Modified residuei294 – 2941N6-acetyllysine; alternateBy similarity
Modified residuei294 – 2941N6-succinyllysine; alternateBy similarity
Modified residuei299 – 2991PhosphoserineBy similarity
Modified residuei325 – 3251PhosphoserineBy similarity
Modified residuei373 – 3731N6-acetyllysineBy similarity
Modified residuei383 – 3831Nitrated tyrosineBy similarity
Modified residuei409 – 4091PhosphoserineBy similarity
Modified residuei412 – 4121PhosphoserineBy similarity
Modified residuei420 – 4201PhosphoserineBy similarity
Modified residuei426 – 4261PhosphothreonineBy similarity
Modified residuei438 – 4381PhosphoserineBy similarity
Modified residuei446 – 4461PhosphothreonineBy similarity
Modified residuei475 – 4751PhosphotyrosineBy similarity

Keywords - PTMi

Acetylation, Nitration, Phosphoprotein

Proteomic databases

MaxQBiP15331.
PRIDEiP15331.

2D gel databases

UCD-2DPAGEP15331.

PTM databases

iPTMnetiP15331.
PhosphoSiteiP15331.

Expressioni

Gene expression databases

CleanExiMM_PRPH.

Interactioni

Protein-protein interaction databases

IntActiP15331. 3 interactions.
MINTiMINT-4107153.

Structurei

3D structure databases

ProteinModelPortaliP15331.
SMRiP15331. Positions 97-236, 263-406.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 103103HeadAdd
BLAST
Regioni104 – 409306RodAdd
BLAST
Regioni104 – 13633Coil 1AAdd
BLAST
Regioni137 – 14711Linker 1Add
BLAST
Regioni148 – 24396Coil 1BAdd
BLAST
Regioni244 – 26623Linker 2Add
BLAST
Regioni267 – 409143Coil 2Add
BLAST
Regioni410 – 47566TailAdd
BLAST

Sequence similaritiesi

Belongs to the intermediate filament family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

HOGENOMiHOG000230977.
HOVERGENiHBG013015.
InParanoidiP15331.
PhylomeDBiP15331.

Family and domain databases

InterProiIPR001664. IF.
IPR006821. Intermed_filament_DNA-bd.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR027700. PRPH/Plasticin.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PTHR23239:SF29. PTHR23239:SF29. 1 hit.
PfamiPF00038. Filament. 1 hit.
PF04732. Filament_head. 1 hit.
[Graphical view]
PRINTSiPR01248. TYPE1KERATIN.
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
PROSITEiPS00226. IF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 5g (identifier: P15331-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSSASMSHH HSSGLRSSIS STSYRRTFGP PPSLSPGAFS YSSSSRFSSS
60 70 80 90 100
RLLGSGSPSS SARLGSFRAP RAGALRLPSE RLDFSMAEAL NQEFLATRSN
110 120 130 140 150
EKQELQELND RFANFIEKVR FLEQQNAALR GELSQARGQE PARADQLCQQ
160 170 180 190 200
ELRELRRELE LLGRERDRVQ VERDGLAEDL AALKQRLEEE TRKREDAEHN
210 220 230 240 250
LVLFRKDVDD ATLSRLELER KIESLMDEIE FLKKLHEEEL RDLQVSVESQ
260 270 280 290 300
QVQQVEVEAT VKPELTAALR DIRAQYENIA AKNLQEAEEW YKSKYADLSD
310 320 330 340 350
AANRNHEALR QAKQEMNESR RQIQSLTCEV DGLRGTNEAL LRQLRELEEQ
360 370 380 390 400
FALEAGGYQA GAARLEEELR QLKEEMARHL REYQELLNVK MALDIEIATY
410 420 430 440 450
RKLLEGEESR ISVPVHSFAS LSLKTTVPEM EPLQDSHSKK MVLIRTIETR
460 470
DGEKVVTESQ KEQHSDLDKS SIHSY
Length:475
Mass (Da):54,268
Last modified:July 15, 1998 - v2
Checksum:i777300B08A312953
GO
Isoform 3u (identifier: P15331-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-294: K → KVREHWGNPGGPRVGRHWEWRCASQPGLSATAQ

Show »
Length:507
Mass (Da):57,834
Checksum:i17267805F7EB06B1
GO
Isoform 5b (identifier: P15331-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-475: KVVTESQKEQHSDLDKSSIHSY → LLRPQPEL

Show »
Length:461
Mass (Da):52,687
Checksum:i933A0F49FF99D55C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei294 – 2941K → KVREHWGNPGGPRVGRHWEW RCASQPGLSATAQ in isoform 3u. CuratedVSP_002466
Alternative sequencei454 – 47522KVVTE…SIHSY → LLRPQPEL in isoform 5b. CuratedVSP_002467Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15475 mRNA. Translation: CAA33502.1.
BC046291 mRNA. Translation: AAH46291.1.
X59840 Genomic DNA. Translation: CAA42499.1.
X59840 Genomic DNA. Translation: CAA42500.1.
X59840 Genomic DNA. Translation: CAA42501.1.
CCDSiCCDS27813.1. [P15331-2]
CCDS49727.1. [P15331-1]
PIRiS14887.
UniGeneiMm.2477.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15475 mRNA. Translation: CAA33502.1.
BC046291 mRNA. Translation: AAH46291.1.
X59840 Genomic DNA. Translation: CAA42499.1.
X59840 Genomic DNA. Translation: CAA42500.1.
X59840 Genomic DNA. Translation: CAA42501.1.
CCDSiCCDS27813.1. [P15331-2]
CCDS49727.1. [P15331-1]
PIRiS14887.
UniGeneiMm.2477.

3D structure databases

ProteinModelPortaliP15331.
SMRiP15331. Positions 97-236, 263-406.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP15331. 3 interactions.
MINTiMINT-4107153.

PTM databases

iPTMnetiP15331.
PhosphoSiteiP15331.

2D gel databases

UCD-2DPAGEP15331.

Proteomic databases

MaxQBiP15331.
PRIDEiP15331.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:97774. Prph.

Phylogenomic databases

HOGENOMiHOG000230977.
HOVERGENiHBG013015.
InParanoidiP15331.
PhylomeDBiP15331.

Miscellaneous databases

PROiP15331.
SOURCEiSearch...

Gene expression databases

CleanExiMM_PRPH.

Family and domain databases

InterProiIPR001664. IF.
IPR006821. Intermed_filament_DNA-bd.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR027700. PRPH/Plasticin.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PTHR23239:SF29. PTHR23239:SF29. 1 hit.
PfamiPF00038. Filament. 1 hit.
PF04732. Filament_head. 1 hit.
[Graphical view]
PRINTSiPR01248. TYPE1KERATIN.
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
PROSITEiPS00226. IF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPERI_MOUSE
AccessioniPrimary (citable) accession number: P15331
Secondary accession number(s): O35688, O35689
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: July 15, 1998
Last modified: September 7, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.