Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peripherin

Gene

Prph

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Class-III neuronal intermediate filament protein.

GO - Molecular functioni

GO - Biological processi

  • intermediate filament cytoskeleton organization Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
Peripherin
Gene namesi
Name:Prph
Synonyms:Prph1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:97774. Prph.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Intermediate filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000637801 – 475PeripherinAdd BLAST475

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei18PhosphoserineBy similarity1
Modified residuei20PhosphoserineBy similarity1
Modified residuei21PhosphoserineBy similarity1
Modified residuei23PhosphoserineBy similarity1
Modified residuei24Nitrated tyrosineBy similarity1
Modified residuei26Omega-N-methylarginineBy similarity1
Modified residuei27PhosphothreonineBy similarity1
Modified residuei35PhosphoserineBy similarity1
Modified residuei40PhosphoserineBy similarity1
Modified residuei43PhosphoserineBy similarity1
Modified residuei48PhosphoserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei57PhosphoserineBy similarity1
Modified residuei60PhosphoserineBy similarity1
Modified residuei85PhosphoserineBy similarity1
Cross-linki102Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei118N6-acetyllysine; alternateBy similarity1
Modified residuei118N6-succinyllysine; alternateBy similarity1
Cross-linki118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei221N6-acetyllysine; alternateBy similarity1
Cross-linki221Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei224PhosphoserineBy similarity1
Modified residuei233N6-acetyllysineBy similarity1
Cross-linki262Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei294N6-acetyllysine; alternateBy similarity1
Modified residuei294N6-succinyllysine; alternateBy similarity1
Cross-linki294Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei299PhosphoserineBy similarity1
Cross-linki313Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei325PhosphoserineBy similarity1
Modified residuei373N6-acetyllysine; alternateBy similarity1
Cross-linki373Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei383Nitrated tyrosineBy similarity1
Modified residuei409PhosphoserineBy similarity1
Modified residuei412PhosphoserineBy similarity1
Modified residuei420PhosphoserineBy similarity1
Modified residuei426PhosphothreonineBy similarity1
Modified residuei438PhosphoserineBy similarity1
Cross-linki439Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei446PhosphothreonineBy similarity1

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Nitration, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP15331.
PRIDEiP15331.

2D gel databases

UCD-2DPAGEiP15331.

PTM databases

iPTMnetiP15331.
PhosphoSitePlusiP15331.

Expressioni

Gene expression databases

CleanExiMM_PRPH.

Interactioni

Protein-protein interaction databases

IntActiP15331. 3 interactors.
MINTiMINT-4107153.

Structurei

3D structure databases

ProteinModelPortaliP15331.
SMRiP15331.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 103HeadAdd BLAST103
Regioni104 – 409RodAdd BLAST306
Regioni104 – 136Coil 1AAdd BLAST33
Regioni137 – 147Linker 1Add BLAST11
Regioni148 – 243Coil 1BAdd BLAST96
Regioni244 – 266Linker 2Add BLAST23
Regioni267 – 409Coil 2Add BLAST143
Regioni410 – 475TailAdd BLAST66

Sequence similaritiesi

Belongs to the intermediate filament family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

HOGENOMiHOG000230977.
HOVERGENiHBG013015.
InParanoidiP15331.
PhylomeDBiP15331.

Family and domain databases

InterProiView protein in InterPro
IPR001664. IF.
IPR006821. Intermed_filament_DNA-bd.
IPR018039. Intermediate_filament_CS.
IPR002957. Keratin_I.
IPR027700. PRPH/Plasticin.
PANTHERiPTHR23239. PTHR23239. 1 hit.
PTHR23239:SF288. PTHR23239:SF288. 1 hit.
PfamiView protein in Pfam
PF00038. Filament. 1 hit.
PF04732. Filament_head. 1 hit.
PRINTSiPR01248. TYPE1KERATIN.
SMARTiView protein in SMART
SM01391. Filament. 1 hit.
PROSITEiView protein in PROSITE
PS00226. IF. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 5g (identifier: P15331-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSSASMSHH HSSGLRSSIS STSYRRTFGP PPSLSPGAFS YSSSSRFSSS
60 70 80 90 100
RLLGSGSPSS SARLGSFRAP RAGALRLPSE RLDFSMAEAL NQEFLATRSN
110 120 130 140 150
EKQELQELND RFANFIEKVR FLEQQNAALR GELSQARGQE PARADQLCQQ
160 170 180 190 200
ELRELRRELE LLGRERDRVQ VERDGLAEDL AALKQRLEEE TRKREDAEHN
210 220 230 240 250
LVLFRKDVDD ATLSRLELER KIESLMDEIE FLKKLHEEEL RDLQVSVESQ
260 270 280 290 300
QVQQVEVEAT VKPELTAALR DIRAQYENIA AKNLQEAEEW YKSKYADLSD
310 320 330 340 350
AANRNHEALR QAKQEMNESR RQIQSLTCEV DGLRGTNEAL LRQLRELEEQ
360 370 380 390 400
FALEAGGYQA GAARLEEELR QLKEEMARHL REYQELLNVK MALDIEIATY
410 420 430 440 450
RKLLEGEESR ISVPVHSFAS LSLKTTVPEM EPLQDSHSKK MVLIRTIETR
460 470
DGEKVVTESQ KEQHSDLDKS SIHSY
Length:475
Mass (Da):54,268
Last modified:July 15, 1998 - v2
Checksum:i777300B08A312953
GO
Isoform 3u (identifier: P15331-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-294: K → KVREHWGNPGGPRVGRHWEWRCASQPGLSATAQ

Show »
Length:507
Mass (Da):57,834
Checksum:i17267805F7EB06B1
GO
Isoform 5b (identifier: P15331-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-475: KVVTESQKEQHSDLDKSSIHSY → LLRPQPEL

Show »
Length:461
Mass (Da):52,687
Checksum:i933A0F49FF99D55C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002466294K → KVREHWGNPGGPRVGRHWEW RCASQPGLSATAQ in isoform 3u. Curated1
Alternative sequenceiVSP_002467454 – 475KVVTE…SIHSY → LLRPQPEL in isoform 5b. CuratedAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15475 mRNA. Translation: CAA33502.1.
BC046291 mRNA. Translation: AAH46291.1.
X59840 Genomic DNA. Translation: CAA42499.1.
X59840 Genomic DNA. Translation: CAA42500.1.
X59840 Genomic DNA. Translation: CAA42501.1.
CCDSiCCDS27813.1. [P15331-2]
CCDS49727.1. [P15331-1]
PIRiS14887.
UniGeneiMm.2477.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPERI_MOUSE
AccessioniPrimary (citable) accession number: P15331
Secondary accession number(s): O35688, O35689
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: July 15, 1998
Last modified: August 30, 2017
This is version 136 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families