P15331 (PERI_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Peripherin | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 475 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Class-III neuronal intermediate filament protein. |
| Sequence similarities | Belongs to the intermediate filament family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Intermediate filament |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Nitration Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intermediate filament cytoskeleton organization Inferred from direct assay PubMed 12642616. Source: MGI |
| Cellular_component | C-fiber Inferred from direct assay PubMed 16029194. Source: MGI neurofilamentInferred from direct assay PubMed 10221457. Source: MGI neuronal cell bodyInferred from sequence orthology PubMed 8616889. Source: MGI photoreceptor outer segment membraneInferred from direct assay PubMed 10414956. Source: MGI |
| Molecular_function | structural molecule activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 5g (identifier: P15331-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3u (identifier: P15331-2) The sequence of this isoform differs from the canonical sequence as follows: 294-294: K → KVREHWGNPGGPRVGRHWEWRCASQPGLSATAQ | ||||||
| Isoform 5b (identifier: P15331-3) The sequence of this isoform differs from the canonical sequence as follows: 454-475: KVVTESQKEQHSDLDKSSIHSY → LLRPQPEL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 475 | 475 | Peripherin | PRO_0000063780 | |||||
Regions | |||||||||
| Region | 1 – 103 | 103 | Head | ||||||
| Region | 104 – 409 | 306 | Rod | ||||||
| Region | 104 – 136 | 33 | Coil 1A | ||||||
| Region | 137 – 147 | 11 | Linker 1 | ||||||
| Region | 148 – 243 | 96 | Coil 1B | ||||||
| Region | 244 – 266 | 23 | Linker 2 | ||||||
| Region | 267 – 409 | 143 | Coil 2 | ||||||
| Region | 410 – 475 | 66 | Tail | ||||||
Amino acid modifications | |||||||||
| Modified residue | 24 | 1 | Nitrated tyrosine By similarity | ||||||
| Modified residue | 383 | 1 | Nitrated tyrosine By similarity | ||||||
| Modified residue | 475 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 294 | 1 | K → KVREHWGNPGGPRVGRHWEW RCASQPGLSATAQ in isoform 3u. | VSP_002466 | |||||
| Alternative sequence | 454 – 475 | 22 | KVVTE…SIHSY → LLRPQPEL in isoform 5b. | VSP_002467 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of the mouse gene encoding peripherin: a neuronal intermediate filament protein." Karpov V., Landon F., Djabali K., Gros F., Portier M.M. Biol. Cell 76:43-48(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: BALB/c. Tissue: Liver. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5G). Strain: FVB/N. Tissue: Colon. |
| [3] | "Multiple mRNAs encode peripherin, a neuronal intermediate filament protein." Landon F., Lemonnier M., Benarous R., Huc C., Fiszman M., Gros F., Portier M.M. EMBO J. 8:1719-1726(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 70-475, ALTERNATIVE SPLICING. |
| [4] | Lubec G., Yang J.W., Zigmond M. Submitted (JUL-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 411-424. Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X15475 mRNA. Translation: CAA33502.1. BC046291 mRNA. Translation: AAH46291.1. X59840 Genomic DNA. Translation: CAA42499.1. X59840 Genomic DNA. Translation: CAA42500.1. X59840 Genomic DNA. Translation: CAA42501.1. |
| IPI | IPI00129527. IPI00230444. IPI00230445. |
| PIR | S14887. |
| UniGene | Mm.2477. |
3D structure databases | |
| ProteinModelPortal | P15331. |
| SMR | P15331. Positions 97-236, 263-406. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P15331. 1 interaction. |
| MINT | MINT-4107153. |
PTM databases | |
| PhosphoSite | P15331. |
2D gel databases | |
| UCD-2DPAGE | P15331. |
Proteomic databases | |
| PaxDb | P15331. |
| PRIDE | P15331. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Organism-specific databases | |
| MGI | MGI:97774. Prph. |
Phylogenomic databases | |
| eggNOG | NOG282699. |
| HOGENOM | HOG000230977. |
| HOVERGEN | HBG013015. |
| OrthoDB | EOG4JWVDP. |
Gene expression databases | |
| CleanEx | MM_PRPH. |
| Genevestigator | P15331. |
| GermOnline | ENSMUSG00000023484. Mus musculus. |
Family and domain databases | |
| InterPro | IPR016044. F. IPR001664. IF. IPR006821. Intermed_filament_DNA-bd. IPR018039. Intermediate_filament_CS. IPR002957. Keratin_I. [Graphical view] |
| PANTHER | PTHR23239. PTHR23239. 1 hit. |
| Pfam | PF00038. Filament. 1 hit. PF04732. Filament_head. 1 hit. [Graphical view] |
| PRINTS | PR01248. TYPE1KERATIN. |
| PROSITE | PS00226. IF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | PERI_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P15331 Secondary accession number(s): O35688, O35689 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
