P15309 (PPAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostatic acid phosphatase Short name=PAP EC=3.1.3.2 Alternative name(s): 5'-nucleotidase Short name=5'-NT EC=3.1.3.5 Ecto-5'-nucleotidase Thiamine monophosphatase Short name=TMPase Cleaved into the following chain: | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 386 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma. Ref.11 Ref.13 Ref.15 Ref.18 Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor. Acts as a tumor suppressor of prostate cancer through dephosphorylation of ERBB2 and deactivation of MAPK-mediated signaling. Ref.11 Ref.13 Ref.15 Ref.18 |
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. Ref.11 A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate. Ref.11 |
| Enzyme regulation | Phosphatase activity inhibited by L+-tartrate, and by its derivative, alpha-benzylaminobenzylphosphonic acid. Ref.10 |
| Subunit structure | Homodimer; dimer formation is required for phosphatase activity By similarity. |
| Subcellular location | Isoform 1: Secreted Ref.12 Ref.14. Isoform 2: Cell membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note: Appears to shuttle between the cell membrane and intracellular vesicles. Colocalizes with FLOT1 at cell membrane and in intracellular vesicles. Colocalizes with LAMP2 on the lysosome membrane. Ref.12 Ref.14 |
| Tissue specificity | Highly expressed in the prostate, restricted to glandular and ductal epithelial cells. Also expressed in bladder, kidney, pancreas, lung, cervix, testis and ovary. Weak expression in a subset of pancreatic islet cells, squamous epithelia, the pilosebaceous unit, colonic neuroendocrine cells and skin adnexal structures. Isoform 2 also expressed in the sarcolemma of skeletal muscle. Levels of this cellular isoform decreased in prostate cancer. Ref.12 Ref.19 |
| Post-translational modification | N-glycosylated. High mannose content, partially sialylated and fucosylated biantennary complex. Also fucosylated with partially sialylated triantennary complex oligosaccharides. Ref.9 Ref.21 Ref.22 Proteolytically cleaved in seminal fluid to produce several peptides. Peptide PAPf39, the most prominent, forms amyloid beta-sheet fibrils, SEVI (semen-derived enhancer of viral infection) which entrap HIV virions, attach them to target cells and enhance infection. SEVI amyloid fibrils are degraded by polyphenol epigallocatechin-3-gallate (EGCG), a constituent of green tea. Target cell attachment and enhancement of HIV infection is inhibited by surfen. Also similarly boosts XMRV (xenotropic murine leukemia virus-related virus) infection. Ref.13 Ref.15 |
| Miscellaneous | Used as a diagnostic tool for staging metastatic prostatic cancer. |
| Sequence similarities | Belongs to the histidine acid phosphatase family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-1222012,EBI-1222012 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P15309-1) Also known as: Secreted PAP; sPAP; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P15309-2) Also known as: TMPase; TM-PAP; cellular PAP; cPAP; The sequence of this isoform differs from the canonical sequence as follows: 380-386: GTEDSTD → VLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 33 – 386 | 354 | Prostatic acid phosphatase | PRO_0000023963 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Peptide | 248 – 286 | 39 | PAPf39 | PRO_0000411250 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 44 | 1 | Nucleophile Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 290 | 1 | Proton donor Probable | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 43 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 47 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 111 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 289 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 49 | 1 | Important for substrate specificity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 138 | 1 | Required for homodimerization By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 144 | 1 | Required for homodimerization By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 206 | 1 | Required for structural stability | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 94 | 1 | N-linked (GlcNAc...) Ref.21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 220 | 1 | N-linked (GlcNAc...) Ref.21 Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 333 | 1 | N-linked (GlcNAc...) Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 161 ↔ 372 | Ref.2 Ref.21 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 215 ↔ 313 | Ref.2 Ref.21 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 347 ↔ 351 | Ref.2 Ref.21 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 380 – 386 | 7 | GTEDSTD → VLKVIFAVAFCLISAVLMVL LFIHIRRGLCWQRESYGNI in isoform 2. | VSP_036023 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 15 | 1 | S → N. Ref.8 Corresponds to variant rs17850347 [ dbSNP | Ensembl ]. | VAR_047960 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 124 | 1 | F → V. Ref.8 Corresponds to variant rs17856254 [ dbSNP | Ensembl ]. | VAR_047961 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 226 | 1 | W → R. Ref.8 Corresponds to variant rs17856253 [ dbSNP | Ensembl ]. | VAR_047962 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 330 | 1 | Y → H. Ref.8 Corresponds to variant rs17851392 [ dbSNP | Ensembl ]. | VAR_047963 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 360 | 1 | V → A. Ref.8 Corresponds to variant rs17850198 [ dbSNP | Ensembl ]. | VAR_047964 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 206 | 1 | W → F: Greatly reduced enzyme activity, marked decrease in structural stability, and increased binding of the inhibitor, L(+)-tartrate. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 206 | 1 | W → L: Reduced enzyme activity, marked decrease in structural stability, and increased binding of the inhibitor, L(+)-tartrate. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 15 – 24 | 10 | SLGFLFLLFF → AFASCFCFFC in CAA37673. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 15 – 24 | 10 | SLGFLFLLFF → ALASCFCFFC in AAA60022. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 15 – 24 | 10 | SLGFLFLLFF → ALASCFCFFC in CAA36422. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 46 | 1 | D → H in CAA37673. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 66 – 73 | 8 | GFGQLTQL → RIWPTHPA in CAA37673. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 66 – 73 | 8 | GFGQLTQL → WIWPTHPA in CAA36422. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 95 | 1 | E → D in AAA60022. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | A → R in AAA60022. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 139 | 1 | Q → E in CAA37673. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 157 | 1 | P → R in CAA37673. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 212 | 1 | P → A in CAA36422. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 215 | 1 | C → S in AAA60022. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 294 | 1 | S → T in AAA60022. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 372 | 1 | C → V in AAA60022. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 383 | 1 | D → N in CAA37673. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 43 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 60 – 62 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 72 – 88 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 89 – 93 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 99 – 101 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 108 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 110 – 123 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 128 – 130 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 136 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 146 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 150 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 155 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 173 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 181 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 184 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 185 – 195 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 208 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 210 – 218 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 229 – 247 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 248 – 251 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 258 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 261 – 276 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 277 – 279 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 288 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 290 – 299 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 313 – 321 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 324 – 332 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 335 – 337 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 340 – 342 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 352 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 353 – 360 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 363 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 371 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of human prostatic acid phosphatase gene." Sharief F.S., Li S.S.-L. Biochem. Biophys. Res. Commun. 184:1468-1476(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Covalent structure, disulfide bonding, and identification of reactive surface and active site residues of human prostatic acid phosphatase." van Etten R.L., Davidson R., Stevis P.E., Macarthur H., Moore D.L. J. Biol. Chem. 266:2313-2319(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, DISULFIDE BONDS, ACTIVE SITE. |
| [3] | "Human prostatic acid phosphatase: cDNA cloning, gene mapping and protein sequence homology with lysosomal acid phosphatase." Sharief F.S., Lee H., Leuderman M.M., Lundwall A., Deaven L.L., Lee C.-L., Li S.S.-L. Biochem. Biophys. Res. Commun. 160:79-86(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Molecular cloning and sequence analysis of cDNA encoding human prostatic acid phosphatase." Vihko P., Virkkunen P., Henttu P., Roiko K., Solin T., Huhtala M.L. FEBS Lett. 236:275-281(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Prostate. |
| [5] | "Nucleotide sequence of human prostatic acid phosphatase determined from a full-length cDNA clone." Tailor P.G., Govindan M.V., Patel P.C. Nucleic Acids Res. 18:4928-4928(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Prostate. |
| [6] | "Nucleotide sequence of human prostatic acid phosphatase ACPP gene, including seven Alu repeats." Sharief F.S., Li S.S.-L. Biochem. Mol. Biol. Int. 33:561-565(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ASN-15; VAL-124; ARG-226; HIS-330 AND ALA-360. Tissue: Prostate. |
| [9] | "Structures of the carbohydrate moieties of human prostatic acid phosphatase elucidated by H1 nuclear magnetic resonance spectroscopy." Risley J.M., Van Etten R.L. Arch. Biochem. Biophys. 258:404-412(1987) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE OF CARBOHYDRATES. |
| [10] | "Covalent modification and site-directed mutagenesis of an active site tryptophan of human prostatic acid phosphatase." Zhang Z., Ostanin K., Van Etten R.L. Acta Biochim. Pol. 44:659-672(1997) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, ENZYME REGULATION, MUTAGENESIS OF TRP-206. |
| [11] | "Prostatic acid phosphatase degrades lysophosphatidic acid in seminal plasma." Tanaka M., Kishi Y., Takanezawa Y., Kakehi Y., Aoki J., Arai H. FEBS Lett. 571:197-204(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ENZYME ACTIVITY. |
| [12] | "Prostatic acid phosphatase is not a prostate specific target." Quintero I.B., Araujo C.L., Pulkka A.E., Wirkkala R.S., Herrala A.M., Eskelinen E.-L., Jokitalo E., Hellstroem P.A., Tuominen H.J., Hirvikoski P.P., Vihko P.T. Cancer Res. 67:6549-6554(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [13] | "Semen-derived amyloid fibrils drastically enhance HIV infection." Munch J., Rucker E., Standker L., Adermann K., Goffinet C., Schindler M., Wildum S., Chinnadurai R., Rajan D., Specht A., Gimenez-Gallego G., Sanchez P.C., Fowler D.M., Koulov A., Kelly J.W., Mothes W., Grivel J.C., Margolis L. Kirchhoff F.Cell 131:1059-1071(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING, MASS SPECTROMETRY, ROLE IN HIV INFECTION. |
| [14] | "Integral and associated lysosomal membrane proteins." Schroeder B., Wrocklage C., Pan C., Jaeger R., Koesters B., Schaefer H., Elsaesser H.-P., Mann M., Hasilik A. Traffic 8:1676-1686(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. Tissue: Placenta. |
| [15] | "Fibrils of prostatic acid phosphatase fragments boost infections with XMRV (xenotropic murine leukemia virus-related virus), a human retrovirus associated with prostate cancer." Hong S., Klein E.A., Das Gupta J., Hanke K., Weight C.J., Nguyen C., Gaughan C., Kim K.A., Bannert N., Kirchhoff F., Munch J., Silverman R.H. J. Virol. 83:6995-7003(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING, ROLE IN XMRV INFECTION. |
| [16] | "The main green tea polyphenol epigallocatechin-3-gallate counteracts semen-mediated enhancement of HIV infection." Hauber I., Hohenberg H., Holstermann B., Hunstein W., Hauber J. Proc. Natl. Acad. Sci. U.S.A. 106:9033-9038(2009) [PubMed] [Europe PMC] [Abstract] Cited for: DEGRADATION OF SEVI AMYLOID FIBRILS. |
| [17] | "Aminoquinoline surfen inhibits the action of SEVI (semen-derived enhancer of viral infection)." Roan N.R., Sowinski S., Munch J., Kirchhoff F., Greene W.C. J. Biol. Chem. 285:1861-1869(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INHIBITION OF SEVI ACTIVITY. |
| [18] | "Human prostatic acid phosphatase, an authentic tyrosine phosphatase, dephosphorylates ErbB-2 and regulates prostate cancer cell growth." Chuang T.D., Chen S.J., Lin F.F., Veeramani S., Kumar S., Batra S.K., Tu Y., Lin M.F. J. Biol. Chem. 285:23598-23606(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [19] | "Prostatic acid phosphatase expression in human tissues." Graddis T.J., McMahan C.J., Tamman J., Page K.J., Trager J.B. Int. J. Clin. Exp. Pathol. 4:295-306(2011) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [20] | "Structural origins of L(+)-tartrate inhibition of human prostatic acid phosphatase." Lacount M.W., Handy G., Lebioda L. J. Biol. Chem. 273:30406-30409(1998) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) IN COMPLEX WITH N-PROPYL-L-TARTRAMATE. |
| [21] | "Crystal structure of human prostatic acid phosphatase." Jakob C.G., Lewinski K., Kuciel R., Ostrowski W., Lebioda L. Prostate 42:211-218(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 33-374, DISULFIDE BONDS, GLYCOSYLATION AT ASN-94 AND ASN-220. |
| [22] | "Crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design." Ortlund E., LaCount M.W., Lebioda L. Biochemistry 42:383-389(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 33-386 IN COMPLEX WITH A PHOSPHATE ION AND INHIBITOR ALPHA-BENZYLAMINOBENZYLPHOSPHONIC ACID, DISULFIDE BONDS, GLYCOSYLATION AT ASN-220 AND ASN-333. |
| [23] | "NMR structure in a membrane environment reveals putative amyloidogenic regions of the SEVI precursor peptide PAP(248-286)." Nanga R.P., Brender J.R., Vivekanandan S., Popovych N., Ramamoorthy A. J. Am. Chem. Soc. 131:17972-17979(2009) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 248-286. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M97589 M97588 Genomic DNA. Translation: AAA60021.1.M34840 mRNA. Translation: AAA69694.1. M24902 mRNA. Translation: AAA60022.1. X52174 mRNA. Translation: CAA36422.1. X53605 mRNA. Translation: CAA37673.1. U07097 U07095 Genomic DNA. Translation: AAB60640.1.CH471052 Genomic DNA. Translation: EAW79203.1. CH471052 Genomic DNA. Translation: EAW79205.1. BC007460 mRNA. Translation: AAH07460.1. BC008493 mRNA. Translation: AAH08493.1. BC016344 mRNA. Translation: AAH16344.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00289983. IPI00396434. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | JH0610. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001090.2. NM_001099.4. NP_001127666.1. NM_001134194.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.433060. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P15309. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000323036. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 130730. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 55. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000336375; ENSP00000337471; ENSG00000014257. ENST00000351273; ENSP00000323036; ENSG00000014257. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 55. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:55. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003eop.4. human. uc010htp.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 55. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC03P132036. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:125. ACPP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB000071. HPA004335. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 171790. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA24449. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG85977. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000231439. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG002203. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K14410. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | FTLPSWA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4NKBVM. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SABIO-RK | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ACPP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000014257. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000560. His_Pase_superF_clade-2. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00328. His_Phos_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00616. HIS_ACID_PHOSPHAT_1. 1 hit. PS00778. HIS_ACID_PHOSPHAT_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL2633. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 55. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 221. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P15309. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PPAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P15309 Secondary accession number(s): D3DNC6 Q96QM0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
