Reviewed,
UniProtKB/Swiss-Prot P15309 (PPAP_HUMAN)
Last modified
June 16, 2009.
Version 91.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Prostatic acid phosphatase EC=3.1.3.2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 386 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. |
| Subunit structure | Homodimer. |
| Subcellular location | Isoform 1: Secreted By similarity. Isoform 2: Lysosome membrane; Single-pass type I membrane protein By similarity. Note: Predominantly localized in the plasma membrane but also detected in intracellular vesicles By similarity. |
| Sequence similarities | Belongs to the histidine acid phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Lysosome Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Hydrolase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Direct protein sequencing |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell lysosomal membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | acid phosphatase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P15309-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P15309-2) The sequence of this isoform differs from the canonical sequence as follows: 380-386: GTEDSTD → VLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI | ||||||
| Note: Predominantly localized in the plasma membrane but also detected in intracellular vesicles (By similarity). |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 33 – 386 | 354 | Prostatic acid phosphatase | PRO_0000023963 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 44 | 1 | Nucleophile By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 290 | 1 | Proton donor Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 94 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 220 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 333 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 161 ↔ 372 | Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 215 ↔ 313 | Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 347 ↔ 351 | Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 380 – 386 | 7 | GTEDSTD → VLKVIFAVAFCLISAVLMVL LFIHIRRGLCWQRESYGNI in isoform 2. | VSP_036023 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 15 | 1 | S → N: dbSNP rs17850347. Ref.7 | VAR_047960 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 124 | 1 | F → V: dbSNP rs17856254. Ref.7 | VAR_047961 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 226 | 1 | W → R: dbSNP rs17856253. Ref.7 | VAR_047962 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 330 | 1 | Y → H: dbSNP rs17851392. Ref.7 | VAR_047963 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 360 | 1 | V → A: dbSNP rs17850198. Ref.7 | VAR_047964 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 15 – 24 | 10 | SLGFLFLLFF → AFASCFCFFC in CAA37673. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 15 – 24 | 10 | SLGFLFLLFF → ALASCFCFFC in AAA60022. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 15 – 24 | 10 | SLGFLFLLFF → ALASCFCFFC in CAA36422. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 46 | 1 | D → H in CAA37673. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 66 – 73 | 8 | GFGQLTQL → RIWPTHPA in CAA37673. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 66 – 73 | 8 | GFGQLTQL → WIWPTHPA in CAA36422. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 95 | 1 | E → D in AAA60022. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | A → R in AAA60022. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 139 | 1 | Q → E in CAA37673. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 157 | 1 | P → R in CAA37673. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 212 | 1 | P → A in CAA36422. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 215 | 1 | C → S in AAA60022. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 294 | 1 | S → T in AAA60022. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 372 | 1 | C → V in AAA60022. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 383 | 1 | D → N in CAA37673. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 43 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 60 – 62 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 72 – 88 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 89 – 93 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 99 – 101 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 108 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 110 – 123 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 128 – 130 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 146 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 150 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 155 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 173 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 181 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 184 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 185 – 195 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 208 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 210 – 218 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 229 – 247 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 248 – 251 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 258 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 261 – 276 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 282 – 288 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 290 – 299 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 313 – 321 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 324 – 332 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 352 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 353 – 360 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 363 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 371 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure of human prostatic acid phosphatase gene." Sharief F.S., Li S.S.-L. Biochem. Biophys. Res. Commun. 184:1468-1476(1992) [PubMed: 1375464] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Covalent structure, disulfide bonding, and identification of reactive surface and active site residues of human prostatic acid phosphatase." van Etten R.L., Davidson R., Stevis P.E., Macarthur H., Moore D.L. J. Biol. Chem. 266:2313-2319(1991) [PubMed: 1989985] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, DISULFIDE BONDS, ACTIVE SITE. |
| [3] | "Human prostatic acid phosphatase: cDNA cloning, gene mapping and protein sequence homology with lysosomal acid phosphatase." Sharief F.S., Lee H., Leuderman M.M., Lundwall A., Deaven L.L., Lee C.-L., Li S.S.-L. Biochem. Biophys. Res. Commun. 160:79-86(1989) [PubMed: 2712834] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Molecular cloning and sequence analysis of cDNA encoding human prostatic acid phosphatase." Vihko P., Virkkunen P., Henttu P., Roiko K., Solin T., Huhtala M.L. FEBS Lett. 236:275-281(1988) [PubMed: 2842184] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Prostate. |
| [5] | "Nucleotide sequence of human prostatic acid phosphatase determined from a full-length cDNA clone." Tailor P.G., Govindan M.V., Patel P.C. Nucleic Acids Res. 18:4928-4928(1990) [PubMed: 2395659] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Prostate. |
| [6] | "Nucleotide sequence of human prostatic acid phosphatase ACPP gene, including seven Alu repeats." Sharief F.S., Li S.S.-L. Biochem. Mol. Biol. Int. 33:561-565(1994) [PubMed: 7951074] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ASN-15; VAL-124; ARG-226; HIS-330 AND ALA-360. Tissue: Prostate. |
| [8] | "Structural origins of L(+)-tartrate inhibition of human prostatic acid phosphatase." Lacount M.W., Handy G., Lebioda L. J. Biol. Chem. 273:30406-30409(1998) [PubMed: 9804805] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
M97589 M97588 Genomic DNA. Translation: AAA60021.1. M34840 mRNA. Translation: AAA69694.1. M24902 mRNA. Translation: AAA60022.1. X52174 mRNA. Translation: CAA36422.1. X53605 mRNA. Translation: CAA37673.1. U07097 U07095 Genomic DNA. Translation: AAB60640.1. BC007460 mRNA. Translation: AAH07460.1. BC008493 mRNA. Translation: AAH08493.1. BC016344 mRNA. Translation: AAH16344.1. | |||||||||||||||||||||||||||||||
| IPI | IPI00289983. IPI00396434. | ||||||||||||||||||||||||||||||
| PIR | JH0610. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001090.2. NP_001127666.1. | ||||||||||||||||||||||||||||||
| UniGene | Hs.433060 | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENSG00000014257. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||
| GeneID | 55. | ||||||||||||||||||||||||||||||
| KEGG | hsa:55. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| GeneCards | GC03P133518. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0022603. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:125. ACPP. | ||||||||||||||||||||||||||||||
| HPA | CAB000071. HPA004335. | ||||||||||||||||||||||||||||||
| MIM | 171790. gene. | ||||||||||||||||||||||||||||||
| PharmGKB | PA24449. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| HOVERGEN | P15309. | ||||||||||||||||||||||||||||||
| OMA | P15309. VHNFTLP. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| BRENDA | 3.1.3.2. 247. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P15309. | ||||||||||||||||||||||||||||||
| Bgee | P15309. | ||||||||||||||||||||||||||||||
| CleanEx | HS_ACPP. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000014257. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR000560. Histidine_acid_Pase. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00328. Acid_phosphat_A. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS00616. HIS_ACID_PHOSPHAT_1. 1 hit. PS00778. HIS_ACID_PHOSPHAT_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||
| NextBio | 221. | ||||||||||||||||||||||||||||||
| PMAP-CutDB | P15309. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | PPAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P15309 Secondary accession number(s): Q96KY0, Q96QK9, Q96QM0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


