Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

3-hydroxy-3-methylglutaryl-coenzyme A reductase 1

Gene

HMG1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the synthesis of mevalonate. The specific precursor of all isoprenoid compounds present in plants.4 Publications

Catalytic activityi

(R)-mevalonate + CoA + 2 NADP+ = (S)-3-hydroxy-3-methylglutaryl-CoA + 2 NADPH.PROSITE-ProRule annotation

Enzyme regulationi

Regulated at the post-translational level in response to alterations of sphingolipid and sterol biosynthetic pathways. Negatively regulated by a PP2A-dependent dephosphorylation occurring at a site different than Ser-577. Completely inhibited by mevinolin (IC50 = 12.5 nM).4 Publications

Pathwayi: (R)-mevalonate biosynthesis

This protein is involved in step 3 of the subpathway that synthesizes (R)-mevalonate from acetyl-CoA.
Proteins known to be involved in the 3 steps of the subpathway in this organism are:
  1. Acetyl-CoA acetyltransferase, cytosolic 1 (AAT1)
  2. Hydroxymethylglutaryl-CoA synthase (HMGS)
  3. 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1), 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMG2)
This subpathway is part of the pathway (R)-mevalonate biosynthesis, which is itself part of Metabolic intermediate biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes (R)-mevalonate from acetyl-CoA, the pathway (R)-mevalonate biosynthesis and in Metabolic intermediate biosynthesis.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei265 – 2651Charge relay systemBy similarity
Active sitei397 – 3971Charge relay systemBy similarity
Active sitei473 – 4731Charge relay systemBy similarity
Active sitei571 – 5711Proton donorPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

  • coenzyme A metabolic process Source: InterPro
  • isopentenyl diphosphate biosynthetic process, mevalonate pathway Source: TAIR
  • isoprenoid biosynthetic process Source: TAIR
  • sterol biosynthetic process Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Isoprene biosynthesis

Keywords - Ligandi

NADP

Enzyme and pathway databases

BioCyciARA:AT1G76490-MONOMER.
MetaCyc:AT1G76490-MONOMER.
ReactomeiR-ATH-191273. Cholesterol biosynthesis.
UniPathwayiUPA00058; UER00103.

Names & Taxonomyi

Protein namesi
Recommended name:
3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (EC:1.1.1.34)
Short name:
AtHMGR1
Short name:
HMG-CoA reductase 1
Gene namesi
Name:HMG1
Synonyms:HMGR1
Ordered Locus Names:At1g76490
ORF Names:F14G6.9, F15M4.1
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

TAIRiAT1G76490.

Subcellular locationi

Isoform Short :

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei47 – 6923HelicalSequence analysisAdd
BLAST
Transmembranei97 – 11721HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • endoplasmic reticulum Source: TAIR
  • endoplasmic reticulum membrane Source: TAIR
  • integral component of membrane Source: UniProtKB-KW
  • peroxisomal membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Disruption phenotypei

Dwarfing, early senescence, and sterility. 65% lower levels in triterpenoids content and 50% lower levels in sterol content. Hmg1 and hmg2 double mutants are lethal during male gametophyte development.3 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 5925923-hydroxy-3-methylglutaryl-coenzyme A reductase 1PRO_0000114433Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi16 – 161N-linked (GlcNAc...)Sequence analysis
Glycosylationi19 – 191N-linked (GlcNAc...)Sequence analysis
Glycosylationi329 – 3291N-linked (GlcNAc...)Sequence analysis
Glycosylationi575 – 5751N-linked (GlcNAc...)Sequence analysis
Modified residuei577 – 5771Phosphoserine2 Publications

Post-translational modificationi

Reversibly inactivated by phosphorylation at Ser-577 by spinach or Brassica oleracea HMGR kinases in a cell-free system. Probably also phosphorylated at additional sites.2 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP14891.
PRIDEiP14891.

PTM databases

iPTMnetiP14891.

Expressioni

Tissue specificityi

Found in all tissues. Isoform Short is expressed at low levels specifically in flowers. Expressed in both the tapetum and microspores.3 Publications

Inductioni

Down-regulated by light in immature leaves, but not in roots. Not regulated by myriocin, squalestatin or terbinafine.3 Publications

Gene expression databases

ExpressionAtlasiP14891. baseline and differential.
GenevisibleiP14891. AT.

Interactioni

Subunit structurei

Interacts (via N-terminus) with B''ALPHA and B''BETA.1 Publication

Protein-protein interaction databases

STRINGi3702.AT1G76490.1.

Structurei

3D structure databases

ProteinModelPortaliP14891.
SMRiP14891. Positions 172-565.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni118 – 17154LinkerBy similarityAdd
BLAST
Regioni172 – 592421CatalyticBy similarityAdd
BLAST

Domaini

The N-terminal domain (1-178) of the short isoform is necessary and sufficient for directing the protein to the endoplasmic reticulum and to spherical structures.

Sequence similaritiesi

Belongs to the HMG-CoA reductase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2480. Eukaryota.
COG1257. LUCA.
HOGENOMiHOG000050844.
InParanoidiP14891.
KOiK00021.
OMAiFKTGDAM.
OrthoDBiEOG093609QN.
PhylomeDBiP14891.

Family and domain databases

CDDicd00643. HMG-CoA_reductase_classI. 1 hit.
Gene3Di1.10.3270.10. 1 hit.
3.30.70.420. 1 hit.
3.90.770.10. 2 hits.
InterProiIPR002202. HMG_CoA_Rdtase.
IPR023074. HMG_CoA_Rdtase_cat.
IPR023076. HMG_CoA_Rdtase_CS.
IPR004554. HMG_CoA_Rdtase_eu_arc.
IPR023282. HMG_CoA_Rdtase_N.
IPR009023. HMG_CoA_Rdtase_NAD(P)-bd_dom.
IPR009029. HMG_CoA_Rdtase_sub-bd_dom.
[Graphical view]
PANTHERiPTHR10572. PTHR10572. 1 hit.
PfamiPF00368. HMG-CoA_red. 1 hit.
[Graphical view]
PRINTSiPR00071. HMGCOARDTASE.
SUPFAMiSSF55035. SSF55035. 1 hit.
SSF56542. SSF56542. 2 hits.
TIGRFAMsiTIGR00533. HMG_CoA_R_NADP. 1 hit.
PROSITEiPS00066. HMG_COA_REDUCTASE_1. 1 hit.
PS00318. HMG_COA_REDUCTASE_2. 1 hit.
PS01192. HMG_COA_REDUCTASE_3. 1 hit.
PS50065. HMG_COA_REDUCTASE_4. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative initiation. AlignAdd to basket

Isoform Short (identifier: P14891-1) [UniParc]FASTAAdd to basket
Also known as: HMGR1S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLRRRPPKP PVTNNNNSNG SFRSYQPRTS DDDHRRRATT IAPPPKASDA
60 70 80 90 100
LPLPLYLTNA VFFTLFFSVA YYLLHRWRDK IRYNTPLHVV TITELGAIIA
110 120 130 140 150
LIASFIYLLG FFGIDFVQSF ISRASGDAWD LADTIDDDDH RLVTCSPPTP
160 170 180 190 200
IVSVAKLPNP EPIVTESLPE EDEEIVKSVI DGVIPSYSLE SRLGDCKRAA
210 220 230 240 250
SIRREALQRV TGRSIEGLPL DGFDYESILG QCCEMPVGYI QIPVGIAGPL
260 270 280 290 300
LLDGYEYSVP MATTEGCLVA STNRGCKAMF ISGGATSTVL KDGMTRAPVV
310 320 330 340 350
RFASARRASE LKFFLENPEN FDTLAVVFNR SSRFARLQSV KCTIAGKNAY
360 370 380 390 400
VRFCCSTGDA MGMNMVSKGV QNVLEYLTDD FPDMDVIGIS GNFCSDKKPA
410 420 430 440 450
AVNWIEGRGK SVVCEAVIRG EIVNKVLKTS VAALVELNML KNLAGSAVAG
460 470 480 490 500
SLGGFNAHAS NIVSAVFIAT GQDPAQNVES SQCITMMEAI NDGKDIHISV
510 520 530 540 550
TMPSIEVGTV GGGTQLASQS ACLNLLGVKG ASTESPGMNA RRLATIVAGA
560 570 580 590
VLAGELSLMS AIAAGQLVRS HMKYNRSSRD ISGATTTTTT TT
Length:592
Mass (Da):63,598
Last modified:April 1, 1990 - v1
Checksum:i7EE10127460D3573
GO
Isoform Long (identifier: P14891-2) [UniParc]FASTAAdd to basket
Also known as: HMGR1L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKKKQAGPQQTCEFVSYKTLLISPSHLSRHLTTSLLSPLSPPWRDYSFPPM

Show »
Length:642
Mass (Da):69,280
Checksum:i1B6A130064AEF1A5
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MKKKQAGPQQTCEFVSYKTL LISPSHLSRHLTTSLLSPLS PPWRDYSFPPM in isoform Long. 1 PublicationVSP_041282

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15032 mRNA. Translation: CAA33139.1.
J04537 mRNA. Translation: AAA76821.1.
L19261 Genomic DNA. Translation: AAA32814.1.
AY488113 mRNA. Translation: AAR83122.1.
AC012394 Genomic DNA. Translation: AAF16652.1.
AC015450 Genomic DNA. Translation: AAG51957.1.
CP002684 Genomic DNA. Translation: AEE35849.1.
AF385690 mRNA. Translation: AAK60283.1.
BT000703 mRNA. Translation: AAN31847.1.
BT010468 mRNA. Translation: AAQ65091.1.
PIRiA32107.
RefSeqiNP_177775.2. NM_106299.3. [P14891-2]
UniGeneiAt.22772.

Genome annotation databases

EnsemblPlantsiAT1G76490.1; AT1G76490.1; AT1G76490. [P14891-2]
GeneIDi843982.
KEGGiath:AT1G76490.

Keywords - Coding sequence diversityi

Alternative initiation

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X15032 mRNA. Translation: CAA33139.1.
J04537 mRNA. Translation: AAA76821.1.
L19261 Genomic DNA. Translation: AAA32814.1.
AY488113 mRNA. Translation: AAR83122.1.
AC012394 Genomic DNA. Translation: AAF16652.1.
AC015450 Genomic DNA. Translation: AAG51957.1.
CP002684 Genomic DNA. Translation: AEE35849.1.
AF385690 mRNA. Translation: AAK60283.1.
BT000703 mRNA. Translation: AAN31847.1.
BT010468 mRNA. Translation: AAQ65091.1.
PIRiA32107.
RefSeqiNP_177775.2. NM_106299.3. [P14891-2]
UniGeneiAt.22772.

3D structure databases

ProteinModelPortaliP14891.
SMRiP14891. Positions 172-565.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT1G76490.1.

PTM databases

iPTMnetiP14891.

Proteomic databases

PaxDbiP14891.
PRIDEiP14891.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G76490.1; AT1G76490.1; AT1G76490. [P14891-2]
GeneIDi843982.
KEGGiath:AT1G76490.

Organism-specific databases

TAIRiAT1G76490.

Phylogenomic databases

eggNOGiKOG2480. Eukaryota.
COG1257. LUCA.
HOGENOMiHOG000050844.
InParanoidiP14891.
KOiK00021.
OMAiFKTGDAM.
OrthoDBiEOG093609QN.
PhylomeDBiP14891.

Enzyme and pathway databases

UniPathwayiUPA00058; UER00103.
BioCyciARA:AT1G76490-MONOMER.
MetaCyc:AT1G76490-MONOMER.
ReactomeiR-ATH-191273. Cholesterol biosynthesis.

Miscellaneous databases

PROiP14891.

Gene expression databases

ExpressionAtlasiP14891. baseline and differential.
GenevisibleiP14891. AT.

Family and domain databases

CDDicd00643. HMG-CoA_reductase_classI. 1 hit.
Gene3Di1.10.3270.10. 1 hit.
3.30.70.420. 1 hit.
3.90.770.10. 2 hits.
InterProiIPR002202. HMG_CoA_Rdtase.
IPR023074. HMG_CoA_Rdtase_cat.
IPR023076. HMG_CoA_Rdtase_CS.
IPR004554. HMG_CoA_Rdtase_eu_arc.
IPR023282. HMG_CoA_Rdtase_N.
IPR009023. HMG_CoA_Rdtase_NAD(P)-bd_dom.
IPR009029. HMG_CoA_Rdtase_sub-bd_dom.
[Graphical view]
PANTHERiPTHR10572. PTHR10572. 1 hit.
PfamiPF00368. HMG-CoA_red. 1 hit.
[Graphical view]
PRINTSiPR00071. HMGCOARDTASE.
SUPFAMiSSF55035. SSF55035. 1 hit.
SSF56542. SSF56542. 2 hits.
TIGRFAMsiTIGR00533. HMG_CoA_R_NADP. 1 hit.
PROSITEiPS00066. HMG_COA_REDUCTASE_1. 1 hit.
PS00318. HMG_COA_REDUCTASE_2. 1 hit.
PS01192. HMG_COA_REDUCTASE_3. 1 hit.
PS50065. HMG_COA_REDUCTASE_4. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHMDH1_ARATH
AccessioniPrimary (citable) accession number: P14891
Secondary accession number(s): Q6RW12
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1990
Last sequence update: April 1, 1990
Last modified: September 7, 2016
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.