P14891 (HMDH1_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 Short name=HMG-CoA reductase 1 Short name=HMGR1 EC=1.1.1.34 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis |
Protein attributes
| Sequence length | 592 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the synthesis of mevalonate. The specific precursor of all isoprenoid compounds present in plants. |
| Catalytic activity | (R)-mevalonate + CoA + 2 NADP+ = (S)-3-hydroxy-3-methylglutaryl-CoA + 2 NADPH. |
| Enzyme regulation | Completely inhibited by mevinolin (IC50 = 12.5 nM). Ref.7 |
| Pathway | |
| Subcellular location | Isoform Short: Endoplasmic reticulum membrane; Multi-pass membrane protein. Isoform Long: Endoplasmic reticulum membrane; Multi-pass membrane protein. |
| Tissue specificity | Found in all tissues. Isoform Short is expressed at low levels specifically in flowers. Ref.3 |
| Post-translational modification | Reversibly inactivated by phosphorylation at Ser-577 by Brassica oleracea HMGR kinase A in a cell-free system. |
| Sequence similarities | Belongs to the HMG-CoA reductase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative initiation. [Align] [Select] | ||||||
| Isoform Short (identifier: P14891-1) Also known as: HMGR1S; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Long (identifier: P14891-2) Also known as: HMGR1L; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKKKQAGPQQTCEFVSYKTLLISPSHLSRHLTTSLLSPLSPPWRDYSFPPM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 592 | 592 | 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 | PRO_0000114433 | |||||
Regions | |||||||||
| Transmembrane | 47 – 69 | 23 | Helical; Potential | ||||||
| Transmembrane | 97 – 117 | 21 | Helical; Potential | ||||||
| Region | 118 – 171 | 54 | Linker By similarity | ||||||
| Region | 172 – 592 | 421 | Catalytic By similarity | ||||||
Sites | |||||||||
| Active site | 265 | 1 | Charge relay system By similarity | ||||||
| Active site | 397 | 1 | Charge relay system By similarity | ||||||
| Active site | 473 | 1 | Charge relay system By similarity | ||||||
| Active site | 571 | 1 | Proton donor By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 16 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 19 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 329 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 575 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MKKKQAGPQQTCEFVSYKTL LISPSHLSRHLTTSLLSPLS PPWRDYSFPPM in isoform Long. | VSP_041282 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and structural characterization of a cDNA encoding Arabidopsis thaliana 3-hydroxy-3-methylglutaryl coenzyme A reductase." Caelles C., Ferrer A., Balcells L., Hegardt F.G., Boronat A. Plant Mol. Biol. 13:627-638(1989) [PubMed: 2491679] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Strain: cv. Columbia. |
| [2] | "3-hydroxy-3-methylglutaryl-coenzyme A reductase from Arabidopsis thaliana is structurally distinct from the yeast and animal enzymes." Learned R.M., Fink G.R. Proc. Natl. Acad. Sci. U.S.A. 86:2779-2783(1989) [PubMed: 2649893] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). |
| [3] | "The use of an alternative promoter in the Arabidopsis thaliana HMG1 gene generates an mRNA that encodes a novel 3-hydroxy-3-methylglutaryl coenzyme A reductase isoform with an extended N-terminal region." Lumbreras V., Campos N., Boronat A. Plant J. 8:541-549(1995) [PubMed: 7496400] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM LONG), TISSUE SPECIFICITY, ALTERNATIVE INITIATION. |
| [4] | "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana." Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. Davis R.W.Nature 408:816-820(2000) [PubMed: 11130712] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [5] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [6] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed: 14593172] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Strain: cv. Columbia. |
| [7] | "Bacterial expression of the catalytic domain of 3-hydroxy-3-methylglutaryl-CoA reductase (isoform HMGR1) from Arabidopsis thaliana, and its inactivation by phosphorylation at Ser577 by Brassica oleracea 3-hydroxy-3-methylglutaryl-CoA reductase kinase." Dale S., Arro M., Becerra B., Morrice N.G., Boronat A., Hardie D.G., Ferrer A. Eur. J. Biochem. 233:506-513(1995) [PubMed: 7588795] [Abstract] Cited for: PROTEIN SEQUENCE OF 573-586, ENZYME REGULATION, PHOSPHORYLATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X15032 mRNA. Translation: CAA33139.1. J04537 mRNA. Translation: AAA76821.1. L19261 Genomic DNA. Translation: AAA32814.1. AY488113 mRNA. Translation: AAR83122.1. AC012394 Genomic DNA. Translation: AAF16652.1. AC015450 Genomic DNA. Translation: AAG51957.1. CP002684 Genomic DNA. Translation: AEE35849.1. AF385690 mRNA. Translation: AAK60283.1. BT000703 mRNA. Translation: AAN31847.1. BT010468 mRNA. Translation: AAQ65091.1. |
| IPI | IPI00545411. IPI01018461. |
| PIR | A32107. |
| RefSeq | NP_177775.2. NM_106299.3. |
| UniGene | At.22772. |
3D structure databases | |
| ProteinModelPortal | P14891. |
| SMR | P14891. Positions 168-569. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P14891. |
Proteomic databases | |
| PRIDE | P14891. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 843982. |
| GenomeReviews | Gene locus AT1G76490 in contig CT485782_GR. |
| KEGG | ath:AT1G76490. |
Organism-specific databases | |
| TAIR | At1g76490. |
Phylogenomic databases | |
| eggNOG | KOG2480. |
| InParanoid | P14891. |
| PhylomeDB | P14891. |
Enzyme and pathway databases | |
| BioCyc | ARA:AT1G76490-MONOMER. MetaCyc:AT1G76490-MONOMER. |
Gene expression databases | |
| Genevestigator | P14891. |
Family and domain databases | |
| InterPro | IPR002202. HMG_CoA_Rdtase. IPR023074. HMG_CoA_Rdtase_cat. IPR023076. HMG_CoA_Rdtase_CS. IPR004554. HMG_CoA_Rdtase_eu_arc. IPR023282. HMG_CoA_Rdtase_N. IPR009023. HMG_CoA_Rdtase_NAD(P)-bd. IPR009029. HMG_CoA_Rdtase_sub-bd. [Graphical view] |
| Gene3D | G3DSA:3.30.70.420. G3DSA:3.30.70.420. 1 hit. G3DSA:3.90.770.10. HMG-CoA_red. 2 hits. G3DSA:1.10.3270.10. HMG_CoA_Rdtase_N. 1 hit. |
| KO | K00021. |
| PANTHER | PTHR10572. HMG-CoA_red. 1 hit. |
| Pfam | PF00368. HMG-CoA_red. 1 hit. [Graphical view] |
| PRINTS | PR00071. HMGCOARDTASE. |
| SUPFAM | SSF55035. HMG_CoA_NAD_bind. 1 hit. SSF56542. HMG_CoA_sub_bind. 1 hit. |
| TIGRFAMs | TIGR00533. HMG_CoA_R_NADP. 1 hit. |
| PROSITE | PS00066. HMG_COA_REDUCTASE_1. 1 hit. PS00318. HMG_COA_REDUCTASE_2. 1 hit. PS01192. HMG_COA_REDUCTASE_3. 1 hit. PS50065. HMG_COA_REDUCTASE_4. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | HMDH1_ARATH | ||||||||
| Accession | Primary (citable) accession number: P14891 Secondary accession number(s): Q6RW12 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with