Reviewed,
UniProtKB/Swiss-Prot P14679 (TYRO_HUMAN)
Last modified
January 19, 2010.
Version 125.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tyrosinase EC=1.14.18.1 Alternative name(s): Monophenol monooxygenase Tumor rejection antigen AB SK29-AB LB24-AB | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 529 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone. |
| Catalytic activity | L-tyrosine + L-dopa + O2 = L-dopa + dopaquinone + H2O. |
| Cofactor | Binds 2 copper ions per subunit. |
| Subcellular location | Melanosome membrane; Single-pass type I membrane protein Ref.14 Ref.15. |
| Induction | Increased expression after UV-B radiation. |
| Polymorphism | Genetic variations in TYR are associated with skin/hair/eye pigmentation type 3 (SHEP3) [MIM:601800]. Hair, eye and skin pigmentation are among the most visible examples of human phenotypic variation, with a broad normal range that is subject to substantial geographic stratification. In the case of skin, individuals tend to have lighter pigmentation with increasing distance from the equator. By contrast, the majority of variation in human eye and hair color is found among individuals of European ancestry, with most other human populations fixed for brown eyes and black hair. Compound heterozygosity for the R402Q polymorphism and a mutant allele of TYR is a common cause of autosomal recessive ocular albinism. The R402Q polymorphism is also found in Waardenburg syndrome type II with ocular albinism (WS2-OA) in association with a deletion in the MITF gene. |
| Involvement in disease | Defects in TYR are the cause of oculocutaneous albinism type IA (OCA-IA) [MIM:203100]; also known as tyrosinase negative oculocutaneous albinism. OCA-IA is an autosomal recessive disorder characterized by absence of pigment in hair, skin and eyes. OCA-IA is characterized by complete lack of tyrosinase activity due to production of an inactive enzyme OCA-IA patients presents with the life-long absence of melanin pigment after birth and manifest increased sensitivity to ultraviolet radiation and to predisposition to skin cancer. Ref.16 Ref.17 Ref.20 Ref.21 Ref.23 Ref.24 Ref.25 Ref.26 Ref.28 Ref.30 Ref.31 Ref.33 Ref.35 Ref.36 Ref.37 Ref.38 Defects in TYR are the cause of oculocutaneous albinism type IB (OCA-IB) [MIM:606952]; also known as albinism yellow mutant type. OCA-IB is characterized by reduced activity of tyrosinase. OCA-IB patients have white hair at birth that rapidly turns yellow or blond. They manifest the development of minimal-to-moderate amounts of cutaneous and ocular pigment. Defects in TYR are the cause of oculocutaneous albinism type I temperature-sensitive (OCA-ITS) [MIM:606952]. OCA-ITS patients have white axillary and scalp hair and pigmented arm and leg hair. |
| Sequence similarities | Belongs to the tyrosinase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P14679-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P14679-2) The sequence of this isoform differs from the canonical sequence as follows: 346-377: GFASPLTGIADASQSSMHNALHIYMNGTMSQV → EMGFLHVGWAGLKLLTSRDPPPWPPKMLGLQA 378-529: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||
| Chain | 19 – 529 | 511 | Tyrosinase | PRO_0000035879 | |||||
Regions | |||||||||
| Topological domain | 19 – 476 | 458 | Lumenal, melanosome Potential | ||||||
| Transmembrane | 477 – 497 | 21 | Potential | ||||||
| Topological domain | 498 – 529 | 32 | Cytoplasmic Potential | ||||||
Sites | |||||||||
| Metal binding | 180 | 1 | Copper A By similarity | ||||||
| Metal binding | 202 | 1 | Copper A By similarity | ||||||
| Metal binding | 211 | 1 | Copper A By similarity | ||||||
| Metal binding | 363 | 1 | Copper B By similarity | ||||||
| Metal binding | 367 | 1 | Copper B By similarity | ||||||
| Metal binding | 390 | 1 | Copper B By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 161 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 230 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 337 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 371 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 346 – 377 | 32 | GFASP…TMSQV → EMGFLHVGWAGLKLLTSRDP PPWPPKMLGLQA in isoform 2. | VSP_006701 | |||||
| Alternative sequence | 378 – 529 | 152 | Missing in isoform 2. | VSP_006702 | |||||
| Natural variant | 19 | 1 | H → Q in OCA-IA. | VAR_007649 | |||||
| Natural variant | 21 | 1 | P → S in OCA-IA. Ref.20 | VAR_007650 | |||||
| Natural variant | 36 | 1 | C → Y in OCA-IA. Ref.33 | VAR_021683 | |||||
| Natural variant | 42 | 1 | D → G in OCA-IA. dbSNP rs28940878. Ref.23 | VAR_007651 | |||||
| Natural variant | 44 | 1 | S → G in OCA-IA. Ref.38 | VAR_021684 | |||||
| Natural variant | 44 | 1 | S → R in OCA-IA. Ref.38 | VAR_021685 | |||||
| Natural variant | 47 | 1 | G → D in OCA-IA. Ref.26 Ref.36 Ref.38 | VAR_007652 | |||||
| Natural variant | 47 | 1 | G → V in OCA-IA. Ref.38 | VAR_021686 | |||||
| Natural variant | 52 | 1 | R → I in OCA-I. | VAR_007653 | |||||
| Natural variant | 55 | 1 | C → Y in OCA-IA. dbSNP rs28940879. Ref.23 Ref.35 | VAR_007654 | |||||
| Natural variant | 68 | 1 | Q → H in OCA-IA. Ref.38 | VAR_021687 | |||||
| Natural variant | 77 | 1 | R → Q in OCA-IA. Ref.33 Ref.36 Ref.38 | VAR_007655 | |||||
| Natural variant | 77 | 1 | R → RR in OCA-IA. Ref.35 | VAR_009236 | |||||
| Natural variant | 77 | 1 | R → W in OCA-IA and OCA-IB. Ref.33 | VAR_007656 | |||||
| Natural variant | 79 | 1 | S → L in OCA-IA. Ref.38 | VAR_021688 | |||||
| Natural variant | 80 | 1 | W → R in OCA-IA. | VAR_007657 | |||||
| Natural variant | 81 | 1 | P → L in OCA-IA. dbSNP rs28940876. Ref.17 Ref.33 Ref.38 | VAR_007658 | |||||
| Natural variant | 89 | 1 | C → R in OCA-IA. dbSNP rs28940877. Ref.21 | VAR_007659 | |||||
| Natural variant | 97 | 1 | G → R in OCA-IA. Ref.33 | VAR_007660 | |||||
| Natural variant | 109 | 1 | G → R in OCA-IA. Ref.36 | VAR_021689 | |||||
| Natural variant | 134 | 1 | F → C: dbSNP rs33955261. | VAR_034576 | |||||
| Natural variant | 142 | 1 | K → N: dbSNP rs11545463. | VAR_042665 | |||||
| Natural variant | 152 | 1 | P → S in OCA-IB. Ref.26 | VAR_007925 | |||||
| Natural variant | 155 | 1 | T → S in OCA-IA. Ref.38 | VAR_021690 | |||||
| Natural variant | 176 | 1 | F → I in OCA-IA. Ref.24 | VAR_007661 | |||||
| Natural variant | 177 | 1 | V → F in OCA-IA. Ref.38 | VAR_021691 | |||||
| Natural variant | 179 | 1 | M → L in OCA-IA. Ref.38 | VAR_021692 | |||||
| Natural variant | 180 | 1 | H → N in OCA-IA. Ref.38 | VAR_021693 | |||||
| Natural variant | 192 | 1 | S → Y Associated with SHEP3; light/dark skin. dbSNP rs1042602. Ref.16 Ref.33 Ref.38 Ref.7 Ref.11 Ref.39 Ref.40 | VAR_007662 | |||||
| Natural variant | 199 | 1 | D → N in OCA-IA. Ref.38 | VAR_021694 | |||||
| Natural variant | 201 | 1 | A → S in OCA-IA. Ref.38 | VAR_021695 | |||||
| Natural variant | 205 | 1 | P → T in OCA-IA. Ref.36 | VAR_021696 | |||||
| Natural variant | 206 | 1 | A → T in OCA-IA. dbSNP rs28940880. Ref.23 | VAR_007663 | |||||
| Natural variant | 216 | 1 | L → M in OCA-IA. | VAR_007664 | |||||
| Natural variant | 217 | 1 | R → G in OCA-IA. | VAR_007665 | |||||
| Natural variant | 217 | 1 | R → Q in OCA-IA. Ref.24 Ref.33 | VAR_007667 | |||||
| Natural variant | 217 | 1 | R → S in OCA-IA. Ref.38 | VAR_021697 | |||||
| Natural variant | 217 | 1 | R → W in OCA-IA. Ref.20 Ref.33 | VAR_007666 | |||||
| Natural variant | 217 | 1 | Missing in OCA-IA. | VAR_007926 | |||||
| Natural variant | 227 | 1 | Missing in OCA-IA. | VAR_021698 | |||||
| Natural variant | 236 | 1 | W → L in OCA-IA. Ref.38 | VAR_021699 | |||||
| Natural variant | 236 | 1 | W → S in OCA-IA. Ref.33 | VAR_021700 | |||||
| Natural variant | 239 | 1 | R → W in OCA-IA. Ref.37 | VAR_021701 | |||||
| Natural variant | 240 | 1 | D → V in OCA-IA. Ref.38 | VAR_021702 | |||||
| Natural variant | 243 | 1 | K → T in OCA-IA. Ref.38 | VAR_021703 | |||||
| Natural variant | 253 | 1 | G → R in OCA-IA. | VAR_007668 | |||||
| Natural variant | 256 | 1 | H → Y in OCA-IA. Ref.36 Ref.38 | VAR_021704 | |||||
| Natural variant | 272 | 1 | W → C in OCA-IA. Ref.33 | VAR_021705 | |||||
| Natural variant | 275 | 1 | V → F in OCA-IB. Ref.36 Ref.18 | VAR_007669 | |||||
| Natural variant | 288 | 1 | L → S in OCA-IA. | VAR_007927 | |||||
| Natural variant | 289 | 1 | C → G in OCA-IA. Ref.35 | VAR_009237 | |||||
| Natural variant | 289 | 1 | C → R in OCA-IA. Ref.33 Ref.38 | VAR_007670 | |||||
| Natural variant | 294 | 1 | E → G in OCA-IA. Ref.33 | VAR_021706 | |||||
| Natural variant | 294 | 1 | E → K in OCA-IA/IB. Ref.26 Ref.33 Ref.36 | VAR_007928 | |||||
| Natural variant | 299 | 1 | R → H in OCA-IA. Ref.20 Ref.26 Ref.35 | VAR_007671 | |||||
| Natural variant | 299 | 1 | R → S in OCA-IB. Ref.35 | VAR_007672 | |||||
| Natural variant | 308 | 1 | R → T: dbSNP rs1042608. | VAR_011825 | |||||
| Natural variant | 312 | 1 | L → V in OCA-I. | VAR_007673 | |||||
| Natural variant | 313 | 1 | P → R in OCA-I. | VAR_007674 | |||||
| Natural variant | 318 | 1 | V → E in OCA-IA. Ref.38 | VAR_021707 | |||||
| Natural variant | 325 | 1 | T → A in OCA-IB. | VAR_007675 | |||||
| Natural variant | 328 | 1 | E → Q in OCA-IA. Ref.25 | VAR_007929 | |||||
| Natural variant | 329 | 1 | S → P in OCA-IA. Ref.38 | VAR_021708 | |||||
| Natural variant | 332 | 1 | M → T in OCA-IA. Ref.38 | VAR_021709 | |||||
| Natural variant | 339 | 1 | S → G in OCA-IA. Ref.36 | VAR_007676 | |||||
| Natural variant | 340 | 1 | F → L in OCA-I. | VAR_007677 | |||||
| Natural variant | 345 | 1 | E → G in OCA-IA. Ref.38 | VAR_021710 | |||||
| Natural variant | 346 | 1 | G → E in OCA-IA. | VAR_007930 | |||||
| Natural variant | 355 | 1 | A → E in OCA-IA. | VAR_007931 | |||||
| Natural variant | 355 | 1 | A → P in OCA-IA and OCA-IB. Ref.33 Ref.36 Ref.38 | VAR_007678 | |||||
| Natural variant | 361 | 1 | S → R in OCA-IA. Ref.28 | VAR_007932 | |||||
| Natural variant | 367 | 1 | H → Y in OCA. Ref.27 | VAR_007933 | |||||
| Natural variant | 370 | 1 | M → T in OCA-IA. Ref.27 | VAR_007934 | |||||
| Natural variant | 371 | 1 | N → T in OCA-IA. | VAR_007679 | |||||
| Natural variant | 371 | 1 | N → Y in OCA-IA. Ref.28 Ref.33 | VAR_007935 | |||||
| Natural variant | 373 | 1 | T → K in OCA-IA. Ref.16 Ref.26 Ref.33 Ref.36 Ref.38 Ref.27 | VAR_007680 | |||||
| Natural variant | 378 | 1 | Q → K in OCA-IA. Ref.38 | VAR_021711 | |||||
| Natural variant | 380 | 1 | S → P in OCA-IB. | VAR_007681 | |||||
| Natural variant | 382 | 1 | N → K in OCA-IA. | VAR_007682 | |||||
| Natural variant | 383 | 1 | D → N in OCA-IA. Ref.16 Ref.36 Ref.38 | VAR_007683 | |||||
| Natural variant | 390 | 1 | H → D in OCA-IB. | VAR_007684 | |||||
| Natural variant | 393 | 1 | V → F in OCA-IA. Ref.38 | VAR_007936 | |||||
| Natural variant | 395 | 1 | S → N in OCA-IA. | VAR_007685 | |||||
| Natural variant | 395 | 1 | S → R in OCA-IA. Ref.38 | VAR_021712 | |||||
| Natural variant | 398 | 1 | E → A in OCA-IA. Ref.38 | VAR_021713 | |||||
| Natural variant | 398 | 1 | E → V in OCA-IA. Ref.38 | VAR_021714 | |||||
| Natural variant | 400 | 1 | W → L in OCA-IA. Ref.35 | VAR_009238 | |||||
| Natural variant | 402 | 1 | R → G in OCA-IB. | VAR_007937 | |||||
| Natural variant | 402 | 1 | R → L in OCA-IA. Ref.38 | VAR_021715 | |||||
| Natural variant | 402 | 1 | R → Q: dbSNP rs1126809. Ref.16 Ref.33 Ref.38 Ref.27 Ref.29 | VAR_007686 | |||||
| Natural variant | 403 | 1 | R → S in OCA-IA and OCA-IB. Ref.20 Ref.33 Ref.38 | VAR_007687 | |||||
| Natural variant | 404 | 1 | H → N in OCA-IA. Ref.38 | VAR_021716 | |||||
| Natural variant | 404 | 1 | H → P in OCA-I. | VAR_007688 | |||||
| Natural variant | 405 | 1 | R → L in OCA-IA. Ref.38 | VAR_021717 | |||||
| Natural variant | 406 | 1 | P → L in OCA-IA and OCA-IB. Ref.33 Ref.38 Ref.18 | VAR_007689 | |||||
| Natural variant | 408 | 1 | Q → H in OCA-IA. Ref.38 | VAR_021718 | |||||
| Natural variant | 409 | 1 | E → D in OCA-IA. Ref.38 | VAR_021719 | |||||
| Natural variant | 416 | 1 | A → S in OCA-IA. Ref.38 | VAR_021720 | |||||
| Natural variant | 417 | 1 | P → H in OCA-IA. Ref.38 | VAR_021721 | |||||
| Natural variant | 419 | 1 | G → R in OCA-IA. Ref.23 Ref.25 Ref.33 Ref.38 | VAR_007690 | |||||
| Natural variant | 422 | 1 | R → Q in OCA-ITS and OCA-IA. Ref.33 Ref.38 Ref.22 | VAR_007691 | |||||
| Natural variant | 424 | 1 | S → F in OCA-IA. Ref.38 | VAR_021722 | |||||
| Natural variant | 426 | 1 | M → K in OCA-IA. Ref.38 | VAR_021723 | |||||
| Natural variant | 427 | 1 | V → G in OCA-IA. Ref.38 | VAR_021724 | |||||
| Natural variant | 431 | 1 | P → L in OCA-IA. Ref.25 | VAR_007938 | |||||
| Natural variant | 434 | 1 | R → I in OCA-IA. Ref.38 | VAR_021725 | |||||
| Natural variant | 435 | 1 | N → D in OCA-IA. Ref.38 | VAR_021726 | |||||
| Natural variant | 439 | 1 | F → V in OCA-IA. Ref.33 | VAR_021727 | |||||
| Natural variant | 444 | 1 | D → G in OCA-IA. Ref.38 | VAR_021728 | |||||
| Natural variant | 446 | 1 | G → S in OCA-IA. Ref.20 Ref.33 Ref.36 | VAR_007692 | |||||
| Natural variant | 448 | 1 | D → N in OCA-IA and OCA-IB. Ref.20 Ref.33 Ref.38 | VAR_007693 | |||||
Experimental info | |||||||||
| Sequence conflict | 42 – 45 | 4 | DRSP → TGV in AAA61241. Ref.2 | ||||||
| Sequence conflict | 179 | 1 | M → I in CAA68756. Ref.4 | ||||||
| Sequence conflict | 373 – 378 | 6 | TMSQVQ → HVPGT in AAA61241. Ref.2 | ||||||
| Sequence conflict | 495 | 1 | L → P in AAA61241. Ref.2 | ||||||
| Sequence conflict | 495 | 1 | L → P in AAA61244. Ref.2 | ||||||
| Sequence conflict | 520 – 523 | 4 | DYHS → GLPQ Ref.2 | ||||||
| Sequence conflict | 525 – 528 | 4 | YQSH → VSEPFIKGLGNRVGPKSPDL TLTQSNVQVPENICWYFL Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Organization and nucleotide sequences of the human tyrosinase gene and a truncated tyrosinase-related segment." Giebel L.B., Strunk K.M., Spritz R.A. Genomics 9:435-445(1991) [PubMed: 1903356] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Isolation and sequence of a cDNA clone for human tyrosinase that maps at the mouse c-albino locus." Kwon B.S., Haq A.K., Pomerantz S.H., Halaban R. Proc. Natl. Acad. Sci. U.S.A. 84:7473-7477(1987) [PubMed: 2823263] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Erratum Kwon B.S., Haq A.K., Pomerantz S.H., Halaban R. Proc. Natl. Acad. Sci. U.S.A. 85:6352-6352(1988) Cited for: SEQUENCE REVISION TO 384-398. |
| [4] | "Induction of pigmentation in mouse fibroblasts by expression of human tyrosinase cDNA." Bouchard B., Fuller B.B., Vijayasaradhi S., Houghton A.N. J. Exp. Med. 169:2029-2042(1989) [PubMed: 2499655] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Melanoma. |
| [5] | "A single base insertion in the putative transmembrane domain of the tyrosinase gene as a cause for tyrosinase-negative oculocutaneous albinism." Chintamaneni C.D., Halaban R., Kobayashi Y., Witkop C.J., Kwon B.S. Proc. Natl. Acad. Sci. U.S.A. 88:5272-5276(1991) [PubMed: 1711223] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "The tyrosinase gene codes for an antigen recognized by autologous cytolytic T lymphocytes on HLA-A2 melanomas." Brichard V., van Pel A., Woelfel T., Woelfel C., de Plaen E., Lethe B.G., Coulie P., Boon T. J. Exp. Med. 178:489-495(1993) [PubMed: 8340755] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). Tissue: Melanoma and T-cell. |
| [7] | "The tyrosinase gene in gorillas and the albinism of 'Snowflake'." Martinez-Arias R., Comas D., Andres A., Abello M.-T., Domingo-Roura X., Bertranpetit J. Pigment Cell Res. 13:467-470(2000) [PubMed: 11153699] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT TYR-192. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
| [9] | "Characteristic sequences in the upstream region of the human tyrosinase gene." Kikuchi H., Miura H., Yamamoto H., Takeuchi T., Dei T., Watanabe M. Biochim. Biophys. Acta 1009:283-286(1989) [PubMed: 2480811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-272. Tissue: Liver. |
| [10] | "Functional analysis of the cDNA encoding human tyrosinase precursor." Takeda A., Tomita Y., Okinaga S., Tagami H., Shibahara S. Biochem. Biophys. Res. Commun. 162:984-990(1989) [PubMed: 2504160] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-32. |
| [11] | "Molecular phylogenetics and the origins of placental mammals." Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.-P., Ryder O.A., O'Brien S.J. Nature 409:614-618(2001) [PubMed: 11214319] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 54-195, VARIANT TYR-192. |
| [12] | "Molecular basis of type I (tyrosinase-related) oculocutaneous albinism: mutations and polymorphisms of the human tyrosinase gene." Oetting W.S., King R.A. Hum. Mutat. 2:1-6(1993) [PubMed: 8477259] [Abstract] Cited for: REVIEW ON OCA VARIANTS. |
| [13] | "Molecular basis of albinism: mutations and polymorphisms of pigmentation genes associated with albinism." Oetting W.S., King R.A. Hum. Mutat. 13:99-115(1999) [PubMed: 10094567] [Abstract] Cited for: REVIEW ON OCA-I VARIANTS. |
| [14] | "Proteomic analysis of early melanosomes: identification of novel melanosomal proteins." Basrur V., Yang F., Kushimoto T., Higashimoto Y., Yasumoto K., Valencia J., Muller J., Vieira W.D., Watabe H., Shabanowitz J., Hearing V.J., Hunt D.F., Appella E. J. Proteome Res. 2:69-79(2003) [PubMed: 12643545] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [15] | "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes." Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F. J. Proteome Res. 5:3135-3144(2006) [PubMed: 17081065] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [16] | "Detection of mutations in the tyrosinase gene in a patient with type IA oculocutaneous albinism." Spritz R.A., Strunk K.M., Giebel L.B., King R.A. N. Engl. J. Med. 322:1724-1728(1990) [PubMed: 2342539] [Abstract] Cited for: VARIANTS OCA-IA LYS-373 AND ASN-383, VARIANTS TYR-192 AND GLN-402. |
| [17] | "A frequent tyrosinase gene mutation in classic, tyrosinase-negative (type IA) oculocutaneous albinism." Giebel L.B., Strunk K.M., King R.A., Hanifin J.M., Spritz R.A. Proc. Natl. Acad. Sci. U.S.A. 87:3255-3258(1990) [PubMed: 1970634] [Abstract] Cited for: VARIANT OCA-IA LEU-81. |
| [18] | "Tyrosinase gene mutations associated with type IB ('yellow') oculocutaneous albinism." Giebel L.B., Tripathi R.K., Strunk K.M., Hanifin J.M., Jackson C.E., King R.A., Spritz R.A. Am. J. Hum. Genet. 48:1159-1167(1991) [PubMed: 1903591] [Abstract] Cited for: VARIANTS OCA-IB PHE-275 AND LEU-406. |
| [19] | Erratum Giebel L.B., Tripathi R.K., Strunk K.M., Hanifin J.M., Jackson C.E., King R.A., Spritz R.A. Am. J. Hum. Genet. 49:696-696(1991) |
| [20] | "Tyrosinase gene mutations in type I (tyrosinase-deficient) oculocutaneous albinism define two clusters of missense substitutions." Tripathi R.K., Strunk K.M., Giebel L.B., Weleber R.G., Spritz R.A. Am. J. Med. Genet. 43:865-871(1992) [PubMed: 1642278] [Abstract] Cited for: VARIANTS OCA-IA SER-21; TRP-217; HIS-299; SER-403; SER-446 AND ASN-448. |
| [21] | "Homozygous tyrosinase gene mutation in an American black with tyrosinase-negative (type IA) oculocutaneous albinism." Spritz R.A., Strunk K.M., Hsieh C.-L., Sekhon G.S., Francke U. Am. J. Hum. Genet. 48:318-324(1991) [PubMed: 1899321] [Abstract] Cited for: VARIANT OCA-IA ARG-89. |
| [22] | "A tyrosinase gene missense mutation in temperature-sensitive type I oculocutaneous albinism. A human homologue to the Siamese cat and the Himalayan mouse." Giebel L.B., Tripathi R.K., King R.A., Spritz R.A. J. Clin. Invest. 87:1119-1122(1991) [PubMed: 1900309] [Abstract] Cited for: VARIANT OCA-ITS GLN-422. |
| [23] | "Non-random distribution of missense mutations within the human tyrosinase gene in type I (tyrosinase-related) oculocutaneous albinism." King R.A., Mentink M.M., Oetting W.S. Mol. Biol. Med. 8:19-29(1991) [PubMed: 1943686] [Abstract] Cited for: VARIANTS OCA-IA GLY-42; TYR-55; THR-206 AND ARG-419. |
| [24] | "Molecular analysis of type I-A (tyrosinase negative) oculocutaneous albinism." Oetting W.S., King R.A. Hum. Genet. 90:258-262(1992) [PubMed: 1487241] [Abstract] Cited for: VARIANTS OCA-IA ILE-176 AND GLN-217. |
| [25] | "Mutations of the tyrosinase gene in Indo-Pakistani patients with type I (tyrosinase-deficient) oculocutaneous albinism (OCA)." Tripathi R.K., Bundey S., Musarella M.A., Droetto S., Strunk K.M., Holmes S.A., Spritz R.A. Am. J. Hum. Genet. 53:1173-1179(1993) [PubMed: 7902671] [Abstract] Cited for: VARIANTS OCA-IA GLN-328; ARG-419 AND LEU-431. |
| [26] | "Mutations of the tyrosinase gene in patients with oculocutaneous albinism from various ethnic groups in Israel." Gershoni-Baruch R., Rosenmann A., Droetto S., Holmes S.A., Tripathi R.K., Spritz R.A. Am. J. Hum. Genet. 54:586-594(1994) [PubMed: 8128955] [Abstract] Cited for: VARIANTS OCA-IA ASP-47; CYS-217 DEL; HIS-299 AND LYS-373, VARIANTS OCA-IB SER-152 AND LYS-294. |
| [27] | "Initiation codon mutation of the tyrosinase gene as a cause of human albinism." Breimer L.H., Winder A.F., Jay B., Jay M. Clin. Chim. Acta 227:17-22(1994) [PubMed: 7955413] [Abstract] Cited for: VARIANTS OCA TYR-367; THR-370 AND LYS-373, VARIANT GLN-402. |
| [28] | "Diagnosis of oculocutaneous albinism with molecular analysis." Summers C.G., Oetting W.S., King R.A. Am. J. Ophthalmol. 121:724-726(1996) [PubMed: 8644824] [Abstract] Cited for: VARIANTS OCA-IA ARG-361 AND TYR-371. |
| [29] | "Apparent digenic inheritance of Waardenburg syndrome type 2 (WS2) and autosomal recessive ocular albinism (AROA)." Morell R., Spritz R.A., Ho L., Pierpont J., Guo W., Friedman T.B., Asher J.H. Jr. Hum. Mol. Genet. 6:659-664(1997) [PubMed: 9158138] [Abstract] Cited for: VARIANT GLN-402. |
| [30] | "Novel mutations of the tyrosinase (TYR) gene in type I oculocutaneous albinism (OCA1)." Spritz R.A., Oh J., Fukai K., Holmes S.A., Ho L., Chitayat D., France T.D., Musarella M.A., Orlow S.J., Schnur R.E., Weleber R.G., Levin A.V. Hum. Mutat. 10:171-174(1997) [PubMed: 9259202] [Abstract] Cited for: VARIANTS OCA-IA AND OCA-IB. |
| [31] | "Mutations of the human tyrosinase gene associated with tyrosinase related oculocutaneous albinism (OCA1)." Oetting W.S., Fryer J.P., King R.A. Hum. Mutat. 12:433-434(1998) [PubMed: 10671066] [Abstract] Cited for: VARIANTS OCA-IA AND OCA-IB. |
| [32] | Erratum Oetting W.S., Fryer J.P., King R.A. Hum. Mutat. 13:83-83(1999) |
| [33] | "Novel and recurrent mutations in the tyrosinase gene and the P gene in the German albino population." Passmore L.A., Kaesmann-Kellner B., Weber B.H.F. Hum. Genet. 105:200-210(1999) [PubMed: 10987646] [Abstract] Cited for: VARIANTS OCA-IA TYR-36; GLN-77; TRP-77; LEU-81; ARG-97; GLN-217; TRP-217; SER-236; CYS-272; ARG-289; GLY-294; LYS-294; PRO-355; TYR-371; LYS-373; LEU-406; ARG-419; GLN-422; VAL-439; SER-446 AND ASN-448, VARIANT OCA-IB SER-403, VARIANTS TYR-192 AND GLN-402. |
| [34] | Erratum Passmore L.A., Kaesmann-Kellner B., Weber B.H.F. Hum. Genet. 108:208-208(2001) |
| [35] | "Insertion/deletion mutations of type I oculocutaneous albinism in Chinese patients from Taiwan." Tsai C.-H., Tsai F.-J., Wu J.-Y., Lin S.-P., Chang J.-G., Yang C.-F., Lee C.-C. Hum. Mutat. 14:542-542(1999) [PubMed: 10571953] [Abstract] Cited for: VARIANTS OCA-IA TYR-55; ARG-77 INS; GLY-289; HIS-299; SER-299 AND LEU-400. |
| [36] | "Mutation analysis of the tyrosinase gene in oculocutaneous albinism." Camand O., Marchant D., Boutboul S., Pequignot M., Odent S., Dollfus H., Sutherland J., Levin A., Menasche M., Marsac C., Dufier J.-L., Heon E., Abitbol M. Hum. Mutat. 17:352-352(2001) [PubMed: 11295837] [Abstract] Cited for: VARIANTS OCA-IA ASP-47; GLN-77; ARG-109; THR-205; TYR-256; PHE-275; LYS-294; GLY-339; PRO-355; LYS-373; ASN-383 AND SER-446. |
| [37] | "A novel mutation of the tyrosinase gene causing oculocutaneous albinism type 1 (OCA1)." Nakamura E., Miyamura Y., Matsunaga J., Kano Y., Dakeishi-Hara M., Tanita M., Kono M., Tomita Y. J. Dermatol. Sci. 28:102-105(2002) [PubMed: 11858948] [Abstract] Cited for: VARIANT OCA-IA TRP-239. |
| [38] | "Detection of 53 novel DNA variations within the tyrosinase gene and accumulation of mutations in 17 patients with albinism." Opitz S., Kaesmann-Kellner B., Kaufmann M., Schwinger E., Zuehlke C. Hum. Mutat. 23:630-631(2004) [PubMed: 15146472] [Abstract] Cited for: VARIANTS OCA-IA ARG-44; GLY-44; ASP-47; VAL-47; HIS-68; GLN-77; LEU-79; LEU-81; SER-155; PHE-177; LEU-179; ASN-180; ASN-199; SER-201; SER-217; LEU-236; VAL-240; THR-243; TYR-256; ARG-289; GLU-318; PRO-329; THR-332; GLY-345; PRO-355; LYS-373; LYS-378; ASN-383; PHE-393; ARG-395; VAL-398; ALA-398; LEU-402; SER-403; ASN-404; LEU-405; LEU-406; HIS-408; ASP-409; SER-416; HIS-417; ARG-419; GLN-422; PHE-424; LYS-426; GLY-427; ILE-434; ASP-435; GLY-444 AND ASN-448, VARIANTS TYR-192 AND GLN-402. |
| [39] | "A genomewide association study of skin pigmentation in a South Asian population." Stokowski R.P., Pant P.V.K., Dadd T., Fereday A., Hinds D.A., Jarman C., Filsell W., Ginger R.S., Green M.R., van der Ouderaa F.J., Cox D.R. Am. J. Hum. Genet. 81:1119-1132(2007) [PubMed: 17999355] [Abstract] Cited for: VARIANT TYR-192, ASSOCIATION WITH SHEP3. |
| [40] | "Genetic determinants of hair, eye and skin pigmentation in Europeans." Sulem P., Gudbjartsson D.F., Stacey S.N., Helgason A., Rafnar T., Magnusson K.P., Manolescu A., Karason A., Palsson A., Thorleifsson G., Jakobsdottir M., Steinberg S., Palsson S., Jonasson F., Sigurgeirsson B., Thorisdottir K., Ragnarsson R., Benediktsdottir K.R. Stefansson K.Nat. Genet. 39:1443-1452(2007) [PubMed: 17952075] [Abstract] Cited for: VARIANT TYR-192, ASSOCIATION WITH SHEP3. |
| + | Additional computationally mapped references. |
Web resources
| Mutations of the TYR gene Retina International's Scientific Newsletter |
| Albinism database (ADB) TYR mutations |
| GeneReviews |
| Protein Spotlight Snowy stardom - Issue 49 of August 2004 |
| Wikipedia Tyrosinase entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M27160 mRNA. Translation: AAB37227.1. M63239 M63238 Genomic DNA. Translation: AAA61242.1. J03581 mRNA. Translation: AAA61241.1. Different initiation. Y00819 mRNA. Translation: CAA68756.1. Different initiation. U01873 mRNA. Translation: AAB60319.1. Sequence problems. M74314 mRNA. Translation: AAA61244.1. X16073 Genomic DNA. Translation: CAA34205.1. AF237811 AF237810 Genomic DNA. Translation: AAK00805.1. BC027179 mRNA. Translation: AAH27179.1. AY012019 Genomic DNA. Translation: AAG38762.1. |
| IPI | IPI00027286. IPI00218270. |
| PIR | YRHU1. A38444. |
| RefSeq | NP_000363.1. |
| UniGene | Hs.503555 |
3D structure databases | |
| SMR | P14679. Positions 116-479. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P14679. |
PTM databases | |
| PhosphoSite | P14679. |
Proteomic databases | |
| PRIDE | P14679. |
Genome annotation databases | |
| Ensembl | ENST00000263321; ENSP00000263321; ENSG00000077498; Homo sapiens. [Genome view] |
| GeneID | 7299. |
| KEGG | hsa:7299. |
| UCSC | uc001pcs.1. human. |
Organism-specific databases | |
| CTD | 7299. |
| GeneCards | GC11P088550. |
| H-InvDB | HIX0010011. |
| HGNC | HGNC:12442. TYR. |
| HPA | CAB000079. |
| MIM | 103470. phenotype. 203100. phenotype. 601800. phenotype. 606933. gene. 606952. phenotype. |
| Orphanet | 1000. Albinism ocular - late onset sensorineural deafness. 55. Oculocutaneous albinism. 895. Waardenburg syndrome type 2. |
| PharmGKB | PA37095. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17034. |
| HOVERGEN | P14679. |
| InParanoid | P14679. |
| OMA | FSFRNTL. |
| OrthoDB | EOG9909VS. |
| PhylomeDB | P14679. |
Enzyme and pathway databases | |
| BRENDA | 1.14.18.1. 247. |
Gene expression databases | |
| ArrayExpress | P14679. |
| Bgee | P14679. |
| CleanEx | HS_TYR. |
| Genevestigator | P14679. |
| GermOnline | ENSG00000077498. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008922. Di-copper_centre. IPR002227. Tyrosinase. [Graphical view] |
| Gene3D | G3DSA:1.10.1280.10. Di-copper_centre. 1 hit. |
| Pfam | PF00264. Tyrosinase. 1 hit. [Graphical view] |
| PRINTS | PR00092. TYROSINASE. |
| PROSITE | PS00497. TYROSINASE_1. 1 hit. PS00498. TYROSINASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00548. Azelaic Acid. DB01055. Mimosine. DB00157. NADH. |
| NextBio | 28547. |
| SOURCE | Search... |
Entry information
| Entry name | TYRO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P14679 Secondary accession number(s): Q15675 Q9BZX1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


