P14679 (TYRO_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 158.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosinase EC=1.14.18.1 Alternative name(s): LB24-AB Monophenol monooxygenase SK29-AB Tumor rejection antigen AB | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 529 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone. |
| Catalytic activity | 2 L-dopa + O2 = 2 dopaquinone + 2 H2O. L-tyrosine + O2 = dopaquinone + H2O. |
| Cofactor | Binds 2 copper ions per subunit. |
| Subcellular location | Melanosome membrane; Single-pass type I membrane protein Ref.14 Ref.15. |
| Induction | Increased expression after UVB irradiation. |
| Polymorphism | Genetic variants in TYR define the skin/hair/eye pigmentation variation locus 3 (SHEP3) [MIM:601800]. Hair, eye and skin pigmentation are among the most visible examples of human phenotypic variation, with a broad normal range that is subject to substantial geographic stratification. In the case of skin, individuals tend to have lighter pigmentation with increasing distance from the equator. By contrast, the majority of variation in human eye and hair color is found among individuals of European ancestry, with most other human populations fixed for brown eyes and black hair. Compound heterozygosity for the R402Q polymorphism and a mutant allele of TYR is a common cause of autosomal recessive ocular albinism. The R402Q polymorphism is also found in Waardenburg syndrome type II with ocular albinism (WS2-OA) in association with a deletion in the MITF gene. |
| Involvement in disease | Albinism oculocutaneous 1A (OCA1A) [MIM:203100]: An autosomal recessive disorder in which the biosynthesis of melanin pigment is absent in skin, hair, and eyes. It is characterized by complete lack of tyrosinase activity due to production of an inactive enzyme. Patients present with a life-long absence of melanin pigment after birth, and manifest increased sensitivity to ultraviolet radiation with predisposition to skin cancer. Visual anomalies include decreased acuity, nystagmus, strabismus and photophobia. Albinism oculocutaneous 1B (OCA1B) [MIM:606952]: An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. It is characterized by partial lack of tyrosinase activity. Patients have white hair at birth that rapidly turns yellow or blond. They manifest the development of minimal-to-moderate amounts of cutaneous and ocular pigment. Some patients may have with white hair in the warmer areas (scalp and axilla) and progressively darker hair in the cooler areas (extremities). This variant phenotype is due to a loss of tyrosinase activity above 35-37 degrees C. |
| Sequence similarities | Belongs to the tyrosinase family. |
| Sequence caution | The sequence AAA61241.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA68756.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P14679-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P14679-2) The sequence of this isoform differs from the canonical sequence as follows: 346-377: GFASPLTGIADASQSSMHNALHIYMNGTMSQV → EMGFLHVGWAGLKLLTSRDPPPWPPKMLGLQA 378-529: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||
| Chain | 19 – 529 | 511 | Tyrosinase | PRO_0000035879 | |||||
Regions | |||||||||
| Topological domain | 19 – 476 | 458 | Lumenal, melanosome Potential | ||||||
| Transmembrane | 477 – 497 | 21 | Helical; Potential | ||||||
| Topological domain | 498 – 529 | 32 | Cytoplasmic Potential | ||||||
Sites | |||||||||
| Metal binding | 180 | 1 | Copper A By similarity | ||||||
| Metal binding | 202 | 1 | Copper A By similarity | ||||||
| Metal binding | 211 | 1 | Copper A By similarity | ||||||
| Metal binding | 363 | 1 | Copper B By similarity | ||||||
| Metal binding | 367 | 1 | Copper B By similarity | ||||||
| Metal binding | 390 | 1 | Copper B By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 86 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 161 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 230 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 337 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 371 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 346 – 377 | 32 | GFASP…TMSQV → EMGFLHVGWAGLKLLTSRDP PPWPPKMLGLQA in isoform 2. | VSP_006701 | |||||
| Alternative sequence | 378 – 529 | 152 | Missing in isoform 2. | VSP_006702 | |||||
| Natural variant | 19 | 1 | H → Q in OCA1A. | VAR_007649 | |||||
| Natural variant | 21 | 1 | P → S in OCA1A. Ref.20 | VAR_007650 | |||||
| Natural variant | 36 | 1 | C → Y in OCA1A. Ref.33 | VAR_021683 | |||||
| Natural variant | 42 | 1 | D → G in OCA1A. Ref.23 Corresponds to variant rs28940878 [ dbSNP | Ensembl ]. | VAR_007651 | |||||
| Natural variant | 44 | 1 | S → G in OCA1A. Ref.38 | VAR_021684 | |||||
| Natural variant | 44 | 1 | S → R in OCA1A. Ref.38 | VAR_021685 | |||||
| Natural variant | 47 | 1 | G → D in OCA1A. Ref.26 Ref.36 Ref.38 | VAR_007652 | |||||
| Natural variant | 47 | 1 | G → V in OCA1A. Ref.38 | VAR_021686 | |||||
| Natural variant | 52 | 1 | R → I in OCA1. | VAR_007653 | |||||
| Natural variant | 55 | 1 | C → Y in OCA1A. Ref.23 Ref.35 Corresponds to variant rs28940879 [ dbSNP | Ensembl ]. | VAR_007654 | |||||
| Natural variant | 68 | 1 | Q → H in OCA1A. Ref.38 | VAR_021687 | |||||
| Natural variant | 77 | 1 | R → Q in OCA1A. Ref.33 Ref.36 Ref.38 | VAR_007655 | |||||
| Natural variant | 77 | 1 | R → RR in OCA1A. Ref.35 | VAR_009236 | |||||
| Natural variant | 77 | 1 | R → W in OCA1A. Ref.33 | VAR_007656 | |||||
| Natural variant | 79 | 1 | S → L in OCA1A. Ref.38 | VAR_021688 | |||||
| Natural variant | 80 | 1 | W → R in OCA1A. | VAR_007657 | |||||
| Natural variant | 81 | 1 | P → L in OCA1A. Ref.17 Ref.33 Ref.38 Corresponds to variant rs28940876 [ dbSNP | Ensembl ]. | VAR_007658 | |||||
| Natural variant | 89 | 1 | C → R in OCA1A. Ref.21 Corresponds to variant rs28940877 [ dbSNP | Ensembl ]. | VAR_007659 | |||||
| Natural variant | 97 | 1 | G → R in OCA1A. Ref.33 | VAR_007660 | |||||
| Natural variant | 109 | 1 | G → R in OCA1A. Ref.36 | VAR_021689 | |||||
| Natural variant | 134 | 1 | F → C. Corresponds to variant rs33955261 [ dbSNP | Ensembl ]. | VAR_034576 | |||||
| Natural variant | 142 | 1 | K → N. Corresponds to variant rs11545463 [ dbSNP | Ensembl ]. | VAR_042665 | |||||
| Natural variant | 152 | 1 | P → S in OCA1B. Ref.26 | VAR_007925 | |||||
| Natural variant | 155 | 1 | T → S in OCA1A. Ref.38 | VAR_021690 | |||||
| Natural variant | 176 | 1 | F → I in OCA1A. Ref.24 | VAR_007661 | |||||
| Natural variant | 177 | 1 | V → F in OCA1A. Ref.38 | VAR_021691 | |||||
| Natural variant | 179 | 1 | M → L in OCA1A. Ref.38 | VAR_021692 | |||||
| Natural variant | 180 | 1 | H → N in OCA1A. Ref.38 | VAR_021693 | |||||
| Natural variant | 192 | 1 | S → Y Associated with SHEP3; light/dark skin. Ref.7 Ref.11 Ref.16 Ref.33 Ref.38 Ref.39 Ref.40 Corresponds to variant rs1042602 [ dbSNP | Ensembl ]. | VAR_007662 | |||||
| Natural variant | 199 | 1 | D → N in OCA1A. Ref.38 | VAR_021694 | |||||
| Natural variant | 201 | 1 | A → S in OCA1A. Ref.38 | VAR_021695 | |||||
| Natural variant | 205 | 1 | P → T in OCA1A. Ref.36 | VAR_021696 | |||||
| Natural variant | 206 | 1 | A → T in OCA1A. Ref.23 Corresponds to variant rs28940880 [ dbSNP | Ensembl ]. | VAR_007663 | |||||
| Natural variant | 216 | 1 | L → M in OCA1A. | VAR_007664 | |||||
| Natural variant | 217 | 1 | R → G in OCA1A. | VAR_007665 | |||||
| Natural variant | 217 | 1 | R → Q in OCA1A. Ref.24 Ref.33 | VAR_007667 | |||||
| Natural variant | 217 | 1 | R → S in OCA1A. Ref.38 | VAR_021697 | |||||
| Natural variant | 217 | 1 | R → W in OCA1A. Ref.20 Ref.33 | VAR_007666 | |||||
| Natural variant | 217 | 1 | Missing in OCA1A. | VAR_007926 | |||||
| Natural variant | 227 | 1 | Missing in OCA1A. | VAR_021698 | |||||
| Natural variant | 236 | 1 | W → L in OCA1A. Ref.38 | VAR_021699 | |||||
| Natural variant | 236 | 1 | W → S in OCA1A. Ref.33 | VAR_021700 | |||||
| Natural variant | 239 | 1 | R → W in OCA1A. Ref.37 | VAR_021701 | |||||
| Natural variant | 240 | 1 | D → V in OCA1A. Ref.38 | VAR_021702 | |||||
| Natural variant | 243 | 1 | K → T in OCA1A. Ref.38 | VAR_021703 | |||||
| Natural variant | 253 | 1 | G → R in OCA1A. | VAR_007668 | |||||
| Natural variant | 256 | 1 | H → Y in OCA1A. Ref.36 Ref.38 | VAR_021704 | |||||
| Natural variant | 272 | 1 | W → C in OCA1A. Ref.33 | VAR_021705 | |||||
| Natural variant | 275 | 1 | V → F in OCA1B. Ref.18 Ref.36 | VAR_007669 | |||||
| Natural variant | 288 | 1 | L → S in OCA1A. | VAR_007927 | |||||
| Natural variant | 289 | 1 | C → G in OCA1A. Ref.35 | VAR_009237 | |||||
| Natural variant | 289 | 1 | C → R in OCA1A. Ref.33 Ref.38 | VAR_007670 | |||||
| Natural variant | 294 | 1 | E → G in OCA1A. Ref.33 | VAR_021706 | |||||
| Natural variant | 294 | 1 | E → K in OCA1A and OCA1B. Ref.26 Ref.33 Ref.36 | VAR_007928 | |||||
| Natural variant | 299 | 1 | R → H in OCA1A. Ref.20 Ref.26 Ref.35 | VAR_007671 | |||||
| Natural variant | 299 | 1 | R → S in OCA1A. Ref.35 | VAR_007672 | |||||
| Natural variant | 308 | 1 | R → T. Corresponds to variant rs1042608 [ dbSNP | Ensembl ]. | VAR_011825 | |||||
| Natural variant | 312 | 1 | L → V in OCA1. | VAR_007673 | |||||
| Natural variant | 313 | 1 | P → R in OCA1. | VAR_007674 | |||||
| Natural variant | 318 | 1 | V → E in OCA1A. Ref.38 | VAR_021707 | |||||
| Natural variant | 325 | 1 | T → A in OCA1B. | VAR_007675 | |||||
| Natural variant | 328 | 1 | E → Q in OCA1A. Ref.25 | VAR_007929 | |||||
| Natural variant | 329 | 1 | S → P in OCA1A. Ref.38 | VAR_021708 | |||||
| Natural variant | 332 | 1 | M → T in OCA1A. Ref.38 | VAR_021709 | |||||
| Natural variant | 339 | 1 | S → G in OCA1A. Ref.36 | VAR_007676 | |||||
| Natural variant | 340 | 1 | F → L in OCA1. | VAR_007677 | |||||
| Natural variant | 345 | 1 | E → G in OCA1A. Ref.38 | VAR_021710 | |||||
| Natural variant | 346 | 1 | G → E in OCA1A. | VAR_007930 | |||||
| Natural variant | 355 | 1 | A → E in OCA1A. | VAR_007931 | |||||
| Natural variant | 355 | 1 | A → P in OCA1A. Ref.33 Ref.36 Ref.38 | VAR_007678 | |||||
| Natural variant | 361 | 1 | S → R in OCA1A. Ref.28 | VAR_007932 | |||||
| Natural variant | 367 | 1 | H → Y in OCA1A. Ref.27 | VAR_007933 | |||||
| Natural variant | 370 | 1 | M → T in OCA1A. Ref.27 | VAR_007934 | |||||
| Natural variant | 371 | 1 | N → T in OCA1A. | VAR_007679 | |||||
| Natural variant | 371 | 1 | N → Y in OCA1A. Ref.28 Ref.33 | VAR_007935 | |||||
| Natural variant | 373 | 1 | T → K in OCA1A. Ref.16 Ref.26 Ref.27 Ref.33 Ref.36 Ref.38 | VAR_007680 | |||||
| Natural variant | 378 | 1 | Q → K in OCA1A. Ref.38 | VAR_021711 | |||||
| Natural variant | 380 | 1 | S → P in OCA1B. | VAR_007681 | |||||
| Natural variant | 382 | 1 | N → K in OCA1A. | VAR_007682 | |||||
| Natural variant | 383 | 1 | D → N in OCA1A. Ref.16 Ref.36 Ref.38 | VAR_007683 | |||||
| Natural variant | 390 | 1 | H → D in OCA1B. | VAR_007684 | |||||
| Natural variant | 393 | 1 | V → F in OCA1A. Ref.38 | VAR_007936 | |||||
| Natural variant | 395 | 1 | S → N in OCA1A. | VAR_007685 | |||||
| Natural variant | 395 | 1 | S → R in OCA1A. Ref.38 | VAR_021712 | |||||
| Natural variant | 398 | 1 | E → A in OCA1A. Ref.38 | VAR_021713 | |||||
| Natural variant | 398 | 1 | E → V in OCA1A. Ref.38 | VAR_021714 | |||||
| Natural variant | 400 | 1 | W → L in OCA1A. Ref.35 | VAR_009238 | |||||
| Natural variant | 402 | 1 | R → G in OCA1B. | VAR_007937 | |||||
| Natural variant | 402 | 1 | R → L in OCA1A. Ref.38 | VAR_021715 | |||||
| Natural variant | 402 | 1 | R → Q. Ref.16 Ref.27 Ref.29 Ref.33 Ref.38 Corresponds to variant rs1126809 [ dbSNP | Ensembl ]. | VAR_007686 | |||||
| Natural variant | 403 | 1 | R → S in OCA1A and OCA1B. Ref.20 Ref.33 Ref.38 | VAR_007687 | |||||
| Natural variant | 404 | 1 | H → N in OCA1A. Ref.38 | VAR_021716 | |||||
| Natural variant | 404 | 1 | H → P in OCA-I. | VAR_007688 | |||||
| Natural variant | 405 | 1 | R → L in OCA1A. Ref.38 | VAR_021717 | |||||
| Natural variant | 406 | 1 | P → L in OCA1A and OCA1B. Ref.18 Ref.33 Ref.38 | VAR_007689 | |||||
| Natural variant | 408 | 1 | Q → H in OCA1A. Ref.38 | VAR_021718 | |||||
| Natural variant | 409 | 1 | E → D in OCA1A. Ref.38 | VAR_021719 | |||||
| Natural variant | 416 | 1 | A → S in OCA1A. Ref.38 | VAR_021720 | |||||
| Natural variant | 417 | 1 | P → H in OCA1A. Ref.38 | VAR_021721 | |||||
| Natural variant | 419 | 1 | G → R in OCA1A. Ref.23 Ref.25 Ref.33 Ref.38 | VAR_007690 | |||||
| Natural variant | 422 | 1 | R → Q in OCA1A and OCA1B; temperature sensitive variant. Ref.22 Ref.33 Ref.38 | VAR_007691 | |||||
| Natural variant | 424 | 1 | S → F in OCA1A. Ref.38 | VAR_021722 | |||||
| Natural variant | 426 | 1 | M → K in OCA1A. Ref.38 | VAR_021723 | |||||
| Natural variant | 427 | 1 | V → G in OCA1A. Ref.38 | VAR_021724 | |||||
| Natural variant | 431 | 1 | P → L in OCA1A. Ref.25 | VAR_007938 | |||||
| Natural variant | 434 | 1 | R → I in OCA1A. Ref.38 | VAR_021725 | |||||
| Natural variant | 435 | 1 | N → D in OCA1A. Ref.38 | VAR_021726 | |||||
| Natural variant | 439 | 1 | F → V in OCA1A. Ref.33 | VAR_021727 | |||||
| Natural variant | 444 | 1 | D → G in OCA1A. Ref.38 | VAR_021728 | |||||
| Natural variant | 446 | 1 | G → S in OCA1A. Ref.20 Ref.33 Ref.36 | VAR_007692 | |||||
| Natural variant | 448 | 1 | D → N in OCA1A. Ref.20 Ref.33 Ref.38 | VAR_007693 | |||||
Experimental info | |||||||||
| Sequence conflict | 42 – 45 | 4 | DRSP → TGV in AAA61241. Ref.2 | ||||||
| Sequence conflict | 179 | 1 | M → I in CAA68756. Ref.4 | ||||||
| Sequence conflict | 373 – 378 | 6 | TMSQVQ → HVPGT in AAA61241. Ref.2 | ||||||
| Sequence conflict | 495 | 1 | L → P in AAA61241. Ref.2 | ||||||
| Sequence conflict | 495 | 1 | L → P in AAA61244. Ref.2 | ||||||
| Sequence conflict | 520 – 523 | 4 | DYHS → GLPQ Ref.2 | ||||||
| Sequence conflict | 525 – 528 | 4 | YQSH → VSEPFIKGLGNRVGPKSPDL TLTQSNVQVPENICWYFL Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Organization and nucleotide sequences of the human tyrosinase gene and a truncated tyrosinase-related segment." Giebel L.B., Strunk K.M., Spritz R.A. Genomics 9:435-445(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Isolation and sequence of a cDNA clone for human tyrosinase that maps at the mouse c-albino locus." Kwon B.S., Haq A.K., Pomerantz S.H., Halaban R. Proc. Natl. Acad. Sci. U.S.A. 84:7473-7477(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Erratum Kwon B.S., Haq A.K., Pomerantz S.H., Halaban R. Proc. Natl. Acad. Sci. U.S.A. 85:6352-6352(1988) Cited for: SEQUENCE REVISION TO 384-398. |
| [4] | "Induction of pigmentation in mouse fibroblasts by expression of human tyrosinase cDNA." Bouchard B., Fuller B.B., Vijayasaradhi S., Houghton A.N. J. Exp. Med. 169:2029-2042(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Melanoma. |
| [5] | "A single base insertion in the putative transmembrane domain of the tyrosinase gene as a cause for tyrosinase-negative oculocutaneous albinism." Chintamaneni C.D., Halaban R., Kobayashi Y., Witkop C.J., Kwon B.S. Proc. Natl. Acad. Sci. U.S.A. 88:5272-5276(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [6] | "The tyrosinase gene codes for an antigen recognized by autologous cytolytic T lymphocytes on HLA-A2 melanomas." Brichard V., van Pel A., Woelfel T., Woelfel C., de Plaen E., Lethe B.G., Coulie P., Boon T. J. Exp. Med. 178:489-495(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). Tissue: Melanoma and T-cell. |
| [7] | "The tyrosinase gene in gorillas and the albinism of 'Snowflake'." Martinez-Arias R., Comas D., Andres A., Abello M.-T., Domingo-Roura X., Bertranpetit J. Pigment Cell Res. 13:467-470(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT TYR-192. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
| [9] | "Characteristic sequences in the upstream region of the human tyrosinase gene." Kikuchi H., Miura H., Yamamoto H., Takeuchi T., Dei T., Watanabe M. Biochim. Biophys. Acta 1009:283-286(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-272. Tissue: Liver. |
| [10] | "Functional analysis of the cDNA encoding human tyrosinase precursor." Takeda A., Tomita Y., Okinaga S., Tagami H., Shibahara S. Biochem. Biophys. Res. Commun. 162:984-990(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-32. |
| [11] | "Molecular phylogenetics and the origins of placental mammals." Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.-P., Ryder O.A., O'Brien S.J. Nature 409:614-618(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 54-195, VARIANT TYR-192. |
| [12] | "Molecular basis of type I (tyrosinase-related) oculocutaneous albinism: mutations and polymorphisms of the human tyrosinase gene." Oetting W.S., King R.A. Hum. Mutat. 2:1-6(1993) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON OCA VARIANTS. |
| [13] | "Molecular basis of albinism: mutations and polymorphisms of pigmentation genes associated with albinism." Oetting W.S., King R.A. Hum. Mutat. 13:99-115(1999) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON OCA1 VARIANTS. |
| [14] | "Proteomic analysis of early melanosomes: identification of novel melanosomal proteins." Basrur V., Yang F., Kushimoto T., Higashimoto Y., Yasumoto K., Valencia J., Muller J., Vieira W.D., Watabe H., Shabanowitz J., Hearing V.J., Hunt D.F., Appella E. J. Proteome Res. 2:69-79(2003) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. Tissue: Melanoma. |
| [15] | "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes." Chi A., Valencia J.C., Hu Z.-Z., Watabe H., Yamaguchi H., Mangini N.J., Huang H., Canfield V.A., Cheng K.C., Yang F., Abe R., Yamagishi S., Shabanowitz J., Hearing V.J., Wu C., Appella E., Hunt D.F. J. Proteome Res. 5:3135-3144(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. Tissue: Melanoma. |
| [16] | "Detection of mutations in the tyrosinase gene in a patient with type IA oculocutaneous albinism." Spritz R.A., Strunk K.M., Giebel L.B., King R.A. N. Engl. J. Med. 322:1724-1728(1990) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A LYS-373 AND ASN-383, VARIANTS TYR-192 AND GLN-402. |
| [17] | "A frequent tyrosinase gene mutation in classic, tyrosinase-negative (type IA) oculocutaneous albinism." Giebel L.B., Strunk K.M., King R.A., Hanifin J.M., Spritz R.A. Proc. Natl. Acad. Sci. U.S.A. 87:3255-3258(1990) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OCA1A LEU-81. |
| [18] | "Tyrosinase gene mutations associated with type IB ('yellow') oculocutaneous albinism." Giebel L.B., Tripathi R.K., Strunk K.M., Hanifin J.M., Jackson C.E., King R.A., Spritz R.A. Am. J. Hum. Genet. 48:1159-1167(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1B PHE-275 AND LEU-406. |
| [19] | Erratum Giebel L.B., Tripathi R.K., Strunk K.M., Hanifin J.M., Jackson C.E., King R.A., Spritz R.A. Am. J. Hum. Genet. 49:696-696(1991) |
| [20] | "Tyrosinase gene mutations in type I (tyrosinase-deficient) oculocutaneous albinism define two clusters of missense substitutions." Tripathi R.K., Strunk K.M., Giebel L.B., Weleber R.G., Spritz R.A. Am. J. Med. Genet. 43:865-871(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A SER-21; TRP-217; HIS-299; SER-403; SER-446 AND ASN-448. |
| [21] | "Homozygous tyrosinase gene mutation in an American black with tyrosinase-negative (type IA) oculocutaneous albinism." Spritz R.A., Strunk K.M., Hsieh C.-L., Sekhon G.S., Francke U. Am. J. Hum. Genet. 48:318-324(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OCA1A ARG-89. |
| [22] | "A tyrosinase gene missense mutation in temperature-sensitive type I oculocutaneous albinism. A human homologue to the Siamese cat and the Himalayan mouse." Giebel L.B., Tripathi R.K., King R.A., Spritz R.A. J. Clin. Invest. 87:1119-1122(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OCA1B GLN-422. |
| [23] | "Non-random distribution of missense mutations within the human tyrosinase gene in type I (tyrosinase-related) oculocutaneous albinism." King R.A., Mentink M.M., Oetting W.S. Mol. Biol. Med. 8:19-29(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A GLY-42; TYR-55; THR-206 AND ARG-419. |
| [24] | "Molecular analysis of type I-A (tyrosinase negative) oculocutaneous albinism." Oetting W.S., King R.A. Hum. Genet. 90:258-262(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A ILE-176 AND GLN-217. |
| [25] | "Mutations of the tyrosinase gene in Indo-Pakistani patients with type I (tyrosinase-deficient) oculocutaneous albinism (OCA)." Tripathi R.K., Bundey S., Musarella M.A., Droetto S., Strunk K.M., Holmes S.A., Spritz R.A. Am. J. Hum. Genet. 53:1173-1179(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A GLN-328; ARG-419 AND LEU-431. |
| [26] | "Mutations of the tyrosinase gene in patients with oculocutaneous albinism from various ethnic groups in Israel." Gershoni-Baruch R., Rosenmann A., Droetto S., Holmes S.A., Tripathi R.K., Spritz R.A. Am. J. Hum. Genet. 54:586-594(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A ASP-47; CYS-217 DEL; HIS-299 AND LYS-373, VARIANTS OCA1B SER-152 AND LYS-294. |
| [27] | "Initiation codon mutation of the tyrosinase gene as a cause of human albinism." Breimer L.H., Winder A.F., Jay B., Jay M. Clin. Chim. Acta 227:17-22(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A TYR-367; THR-370 AND LYS-373, VARIANT GLN-402. |
| [28] | "Diagnosis of oculocutaneous albinism with molecular analysis." Summers C.G., Oetting W.S., King R.A. Am. J. Ophthalmol. 121:724-726(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A ARG-361 AND TYR-371. |
| [29] | "Apparent digenic inheritance of Waardenburg syndrome type 2 (WS2) and autosomal recessive ocular albinism (AROA)." Morell R., Spritz R.A., Ho L., Pierpont J., Guo W., Friedman T.B., Asher J.H. Jr. Hum. Mol. Genet. 6:659-664(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GLN-402. |
| [30] | "Novel mutations of the tyrosinase (TYR) gene in type I oculocutaneous albinism (OCA1)." Spritz R.A., Oh J., Fukai K., Holmes S.A., Ho L., Chitayat D., France T.D., Musarella M.A., Orlow S.J., Schnur R.E., Weleber R.G., Levin A.V. Hum. Mutat. 10:171-174(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A AND OCA1B. |
| [31] | "Mutations of the human tyrosinase gene associated with tyrosinase related oculocutaneous albinism (OCA1)." Oetting W.S., Fryer J.P., King R.A. Hum. Mutat. 12:433-434(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A AND OCA1B. |
| [32] | Erratum Oetting W.S., Fryer J.P., King R.A. Hum. Mutat. 13:83-83(1999) |
| [33] | "Novel and recurrent mutations in the tyrosinase gene and the P gene in the German albino population." Passmore L.A., Kaesmann-Kellner B., Weber B.H.F. Hum. Genet. 105:200-210(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A TYR-36; GLN-77; TRP-77; LEU-81; ARG-97; GLN-217; TRP-217; SER-236; CYS-272; ARG-289; GLY-294; LYS-294; PRO-355; TYR-371; LYS-373; LEU-406; ARG-419; GLN-422; VAL-439; SER-446 AND ASN-448, VARIANT OCA1B SER-403, VARIANTS TYR-192 AND GLN-402. |
| [34] | Erratum Passmore L.A., Kaesmann-Kellner B., Weber B.H.F. Hum. Genet. 108:208-208(2001) |
| [35] | "Insertion/deletion mutations of type I oculocutaneous albinism in Chinese patients from Taiwan." Tsai C.-H., Tsai F.-J., Wu J.-Y., Lin S.-P., Chang J.-G., Yang C.-F., Lee C.-C. Hum. Mutat. 14:542-542(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A TYR-55; ARG-77 INS; GLY-289; HIS-299; SER-299 AND LEU-400. |
| [36] | "Mutation analysis of the tyrosinase gene in oculocutaneous albinism." Camand O., Marchant D., Boutboul S., Pequignot M., Odent S., Dollfus H., Sutherland J., Levin A., Menasche M., Marsac C., Dufier J.-L., Heon E., Abitbol M. Hum. Mutat. 17:352-352(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A ASP-47; GLN-77; ARG-109; THR-205; TYR-256; PHE-275; LYS-294; GLY-339; PRO-355; LYS-373; ASN-383 AND SER-446. |
| [37] | "A novel mutation of the tyrosinase gene causing oculocutaneous albinism type 1 (OCA1)." Nakamura E., Miyamura Y., Matsunaga J., Kano Y., Dakeishi-Hara M., Tanita M., Kono M., Tomita Y. J. Dermatol. Sci. 28:102-105(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT OCA1A TRP-239. |
| [38] | "Detection of 53 novel DNA variations within the tyrosinase gene and accumulation of mutations in 17 patients with albinism." Opitz S., Kaesmann-Kellner B., Kaufmann M., Schwinger E., Zuehlke C. Hum. Mutat. 23:630-631(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS OCA1A ARG-44; GLY-44; ASP-47; VAL-47; HIS-68; GLN-77; LEU-79; LEU-81; SER-155; PHE-177; LEU-179; ASN-180; ASN-199; SER-201; SER-217; LEU-236; VAL-240; THR-243; TYR-256; ARG-289; GLU-318; PRO-329; THR-332; GLY-345; PRO-355; LYS-373; LYS-378; ASN-383; PHE-393; ARG-395; VAL-398; ALA-398; LEU-402; SER-403; ASN-404; LEU-405; LEU-406; HIS-408; ASP-409; SER-416; HIS-417; ARG-419; GLN-422; PHE-424; LYS-426; GLY-427; ILE-434; ASP-435; GLY-444 AND ASN-448, VARIANTS TYR-192 AND GLN-402. |
| [39] | "A genomewide association study of skin pigmentation in a South Asian population." Stokowski R.P., Pant P.V.K., Dadd T., Fereday A., Hinds D.A., Jarman C., Filsell W., Ginger R.S., Green M.R., van der Ouderaa F.J., Cox D.R. Am. J. Hum. Genet. 81:1119-1132(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT TYR-192, ASSOCIATION WITH SHEP3. |
| [40] | "Genetic determinants of hair, eye and skin pigmentation in Europeans." Sulem P., Gudbjartsson D.F., Stacey S.N., Helgason A., Rafnar T., Magnusson K.P., Manolescu A., Karason A., Palsson A., Thorleifsson G., Jakobsdottir M., Steinberg S., Palsson S., Jonasson F., Sigurgeirsson B., Thorisdottir K., Ragnarsson R., Benediktsdottir K.R. Stefansson K.Nat. Genet. 39:1443-1452(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT TYR-192, ASSOCIATION WITH SHEP3. |
| + | Additional computationally mapped references. |
Web resources
| Mutations of the TYR gene Retina International's Scientific Newsletter |
| Albinism database (ADB) TYR mutations |
| GeneReviews |
| Protein Spotlight Snowy stardom - Issue 49 of August 2004 |
| Wikipedia Tyrosinase entry |
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M27160 mRNA. Translation: AAB37227.1. M63239 M63238 Genomic DNA. Translation: AAA61242.1.J03581 mRNA. Translation: AAA61241.1. Different initiation. Y00819 mRNA. Translation: CAA68756.1. Different initiation. U01873 mRNA. Translation: AAB60319.1. Sequence problems. M74314 mRNA. Translation: AAA61244.1. X16073 Genomic DNA. Translation: CAA34205.1. AF237811 AF237810 Genomic DNA. Translation: AAK00805.1.BC027179 mRNA. Translation: AAH27179.1. AY012019 Genomic DNA. Translation: AAG38762.1. |
| IPI | IPI00027286. IPI00218270. |
| PIR | YRHU1. A38444. |
| RefSeq | NP_000363.1. NM_000372.4. |
| UniGene | Hs.503555. |
3D structure databases | |
| ProteinModelPortal | P14679. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000263321. |
PTM databases | |
| PhosphoSite | P14679. |
Polymorphism databases | |
| DMDM | 401235. |
Proteomic databases | |
| PaxDb | P14679. |
| PRIDE | P14679. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000263321; ENSP00000263321; ENSG00000077498. |
| GeneID | 7299. |
| KEGG | hsa:7299. |
| UCSC | uc001pcs.3. human. |
Organism-specific databases | |
| CTD | 7299. |
| GeneCards | GC11P088911. |
| HGNC | HGNC:12442. TYR. |
| HPA | CAB000079. |
| MIM | 103470. phenotype. 203100. phenotype. 601800. phenotype. 606933. gene. 606952. phenotype. |
| neXtProt | NX_P14679. |
| Orphanet | 79431. Oculocutaneous albinism type 1A. 79434. Oculocutaneous albinism type 1B. 895. Waardenburg syndrome type 2. |
| PharmGKB | PA37095. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG08919. |
| HOVERGEN | HBG003553. |
| InParanoid | P14679. |
| KO | K00505. |
| OMA | CLSLTQY. |
| OrthoDB | EOG4D26PK. |
| PhylomeDB | P14679. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS01248-MONOMER. |
Gene expression databases | |
| ArrayExpress | P14679. |
| Bgee | P14679. |
| CleanEx | HS_TYR. |
| Genevestigator | P14679. |
| GermOnline | ENSG00000077498. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.1280.10. 1 hit. |
| InterPro | IPR002227. Tyrosinase. IPR008922. Unchr_di-copper_centre. [Graphical view] |
| Pfam | PF00264. Tyrosinase. 1 hit. [Graphical view] |
| PRINTS | PR00092. TYROSINASE. |
| SUPFAM | SSF48056. Di-copper_centre. 1 hit. |
| PROSITE | PS00497. TYROSINASE_1. 1 hit. PS00498. TYROSINASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P14679. |
| ChEMBL | CHEMBL1973. |
| DrugBank | DB00548. Azelaic Acid. DB01055. Mimosine. DB00157. NADH. |
| GenomeRNAi | 7299. |
| NextBio | 28547. |
| SOURCE | Search... |
Entry information
| Entry name | TYRO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P14679 Secondary accession number(s): Q15675 Q9BZX1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |

Clusters with
