P14678 (RSMB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 143.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Small nuclear ribonucleoprotein-associated proteins B and B' Short name=snRNP-B Alternative name(s): Sm protein B/B' Short name=Sm-B/B' Short name=SmB/B' | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 240 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner By similarity. |
| Subunit structure | Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1 By similarity. Component of the heptameric ring U7 snRNP complex, or U7 Sm protein core complex, at least composed of LSM10, LSM11, SNRPB, SNRPD3, SNRPE, SNRPF, SNRPG and U7 snRNA. Formation of the U7 snRNP is an ATP-dependent process mediated by a specialized SMN complex containing at least the Sm protein core complex and additionally, the U7-specific LSM10 and LSM11 proteins. Identified in the spliceosome C complex. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome. Interacts with CLNS1A, DDX20, LSM11, TDRD3, SNUPN and SMN1. Ref.13 Ref.15 Ref.18 Ref.19 |
| Subcellular location | |
| Post-translational modification | Methylated. Arg-108 and Arg-112 are dimethylated, probably to asymmetric dimethylarginine. Ref.10 Ref.16 Ref.19 |
| Miscellaneous | Patients with the autoimmune disease systemic lupus erythematosus (SLE) have autoantibodies directed against some of the individual snRNP polypeptides. The most common autoantigen is called Sm. B/b' bear Sm epitopes. |
| Sequence similarities | Belongs to the snRNP SmB/SmN family. |
| Sequence caution | The sequence AAD54488.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SMN1 | Q16637-3 | 3 | EBI-372471,EBI-395447 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SM-B' (identifier: P14678-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SM-B (identifier: P14678-2) The sequence of this isoform differs from the canonical sequence as follows: 230-240: PPPPGMRPPRP → LL | ||||||
| Isoform SM-B1 (identifier: P14678-3) The sequence of this isoform differs from the canonical sequence as follows: 227-228: MR → GCEAFFDPWPQSMEVAPQRRGLDSSGPRYHRPVCFLCCCSWSLMGLSGFLT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 240 | 240 | Small nuclear ribonucleoprotein-associated proteins B and B' | PRO_0000125517 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Repeat | 175 – 181 | 7 | ||||||||||||||||||||
| Repeat | 191 – 196 | 6 | ||||||||||||||||||||
| Repeat | 216 – 221 | 6 | ||||||||||||||||||||
| Repeat | 222 – 228 | 7 | ||||||||||||||||||||
| Repeat | 230 – 236 | 7 | ||||||||||||||||||||
| Region | 175 – 236 | 62 | Repeat-rich region | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Modified residue | 108 | 1 | Omega-N-methylated arginine Ref.10 Ref.16 | |||||||||||||||||||
| Modified residue | 112 | 1 | Dimethylated arginine; in A2780 ovarian carcinoma cell line Ref.10 Ref.16 | |||||||||||||||||||
| Modified residue | 112 | 1 | Omega-N-methylated arginine Ref.10 Ref.16 | |||||||||||||||||||
| Modified residue | 147 | 1 | Omega-N-methylarginine Ref.10 | |||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 227 – 228 | 2 | MR → GCEAFFDPWPQSMEVAPQRR GLDSSGPRYHRPVCFLCCCS WSLMGLSGFLT in isoform SM-B1. | VSP_012221 | ||||||||||||||||||
| Alternative sequence | 230 – 240 | 11 | PPPPGMRPPRP → LL in isoform SM-B. | VSP_005914 | ||||||||||||||||||
| Natural variant | 79 | 1 | S → P. Corresponds to variant rs11545672 [ dbSNP | Ensembl ]. | VAR_052274 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Sequence conflict | 172 – 173 | 2 | RG → L Ref.4 | |||||||||||||||||||
| Sequence conflict | 201 | 1 | Missing Ref.4 | |||||||||||||||||||
| Sequence conflict | 217 – 218 | 2 | PP → S Ref.4 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Helix | 10 – 12 | 3 | ||||||||||||||||||||
| Beta strand | 15 – 21 | 7 | ||||||||||||||||||||
| Beta strand | 26 – 33 | 8 | ||||||||||||||||||||
| Beta strand | 40 – 51 | 12 | ||||||||||||||||||||
| Beta strand | 61 – 72 | 12 | ||||||||||||||||||||
| Helix | 74 – 76 | 3 | ||||||||||||||||||||
| Beta strand | 77 – 84 | 8 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloned human snRNP proteins B and B' differ only in their carboxy-terminal part." van Dam A., Winkel I., Zijlstra-Baalbergen J., Smeenk R., Cuypers H.T. EMBO J. 8:3853-3860(1989) [PubMed: 2531083] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SM-B AND SM-B'). |
| [2] | "A comparison of snRNP-associated Sm-autoantigens: human N, rat N and human B/B'." Schmauss C., McAllister G., Ohosone Y., Hardin J.A., Lerner M.R. Nucleic Acids Res. 17:1733-1743(1989) [PubMed: 2522186] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SM-B). Tissue: Thyroid carcinoma. |
| [3] | Erratum Schmauss C., McAllister G., Ohosone Y., Hardin J.A., Lerner M.R. Nucleic Acids Res. 17:6777-6777(1989) |
| [4] | "Molecular cloning of cDNA encoding Sm autoantigen: derivation of a cDNA for a B polypeptide of the U series of small nuclear ribonucleoprotein particles." Ohosone Y., Mimori T., Griffith A., Akizuki M., Homma M., Craft J., Hardin J.A. Proc. Natl. Acad. Sci. U.S.A. 86:4249-4253(1989) [PubMed: 2524838] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SM-B1). Tissue: Fibroblast. |
| [5] | "Concerted regulation and molecular evolution of the duplicated SNRPB'/B and SNRPN loci." Gray T.A., Smithwick M.J., Schaldach M.A., Martone D.L., Graves J.A., McCarrey J.R., Nicholls R.D. Nucleic Acids Res. 27:4577-4584(1999) [PubMed: 10556313] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SM-B'). |
| [7] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "Epitope mapping of recombinant HeLa SmB and B' peptides obtained by the polymerase chain reaction." Elkon K.B., Hines J.J., Chu J.-L., Parnassa A. J. Immunol. 145:636-643(1990) [PubMed: 1694885] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-240 (ISOFORMS SM-B AND SM-B'). |
| [10] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 9-16; 19-32 AND 66-147, METHYLATION AT ARG-108; ARG-112 AND ARG-147, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [11] | "The small nuclear ribonucleoproteins, SmB and B', are products of a single gene." Chu J.-L., Elkon K.B. Gene 97:311-312(1991) [PubMed: 1825643] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 209-240. |
| [12] | "Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein." Pillai R.S., Will C.L., Luehrmann R., Schuemperli D., Mueller B. EMBO J. 20:5470-5479(2001) [PubMed: 11574479] [Abstract] Cited for: IDENTIFICATION IN THE U7 SNRNP COMPLEX. |
| [13] | "SMN, the spinal muscular atrophy protein, forms a pre-import snRNP complex with snurportin1 and importin beta." Narayanan U., Ospina J.K., Frey M.R., Hebert M.D., Matera A.G. Hum. Mol. Genet. 11:1785-1795(2002) [PubMed: 12095920] [Abstract] Cited for: INTERACTION WITH DDX20; SNUPN AND SMN1. |
| [14] | "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis." Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J. RNA 8:426-439(2002) [PubMed: 11991638] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE SPLICEOSOMAL C COMPLEX. |
| [15] | "Unique Sm core structure of U7 snRNPs: assembly by a specialized SMN complex and the role of a new component, Lsm11, in histone RNA processing." Pillai R.S., Grimmler M., Meister G., Will C.L., Luehrmann R., Fischer U., Schuemperli D. Genes Dev. 17:2321-2333(2003) [PubMed: 12975319] [Abstract] Cited for: INTERACTION WITH LSM11. Tissue: Cervix carcinoma. |
| [16] | "Identifying and quantifying in vivo methylation sites by heavy methyl SILAC." Ong S.E., Mittler G., Mann M. Nat. Methods 1:119-126(2004) [PubMed: 15782174] [Abstract] Cited for: METHYLATION [LARGE SCALE ANALYSIS] AT ARG-108 AND ARG-112, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome." Will C.L., Schneider C., Hossbach M., Urlaub H., Rauhut R., Elbashir S., Tuschl T., Luehrmann R. RNA 10:929-941(2004) [PubMed: 15146077] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH THE U11/U12 SPLICEOSOME, MASS SPECTROMETRY. |
| [18] | "Tudor domains bind symmetrical dimethylated arginines." Cote J., Richard S. J. Biol. Chem. 280:28476-28483(2005) [PubMed: 15955813] [Abstract] Cited for: INTERACTION WITH TDRD3. |
| [19] | "Toward an assembly line for U7 snRNPs: interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes." Azzouz T.N., Pillai R.S., Dapp C., Chari A., Meister G., Kambach C., Fischer U., Schuemperli D. J. Biol. Chem. 280:34435-34440(2005) [PubMed: 16087681] [Abstract] Cited for: INTERACTION WITH CLNS1A AND SMN, METHYLATION. |
| [20] | "Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs." Kambach C., Walke S., Young R., Avis J.M., de la Fortelle E., Raker V.A., Luehrmann R., Li J., Nagai K. Cell 96:375-387(1999) [PubMed: 10025403] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X17567 mRNA. Translation: CAB57867.1. X17568 mRNA. Translation: CAB57868.1. X15893 mRNA. Translation: CAA33902.1. AF134825 AF134824 Genomic DNA. Translation: AAD54488.1. Sequence problems.AL049650 Genomic DNA. Translation: CAB46715.1. CH471133 Genomic DNA. Translation: EAX10596.1. CR456969 mRNA. Translation: CAG33250.1. AL049650 Genomic DNA. Translation: CAB46714.1. M34081 mRNA. Translation: AAA36578.1. M34082 mRNA. Translation: AAA36579.1. X52979 Genomic DNA. Translation: CAA37170.1. X52979 Genomic DNA. Translation: CAA37171.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00027285. IPI00329512. IPI00395674. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S09377. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_003082.1. NM_003091.3. NP_937859.1. NM_198216.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.83753. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P14678. Positions 1-95. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-31239N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P14678. 30 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-124876. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 134037. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000438552; ENSP00000412566; ENSG00000125835. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 6628. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6628. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002wfz.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 6628. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC20M002442. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:11153. SNRPB. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB009610. HPA003482. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 182282. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA35995. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG17303. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00600000084349. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG001019. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG44MXTD. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_1675. mRNA Processing. REACT_1788. Transcription. REACT_71. Gene Expression. REACT_78. Post-Elongation Processing of the Transcript. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SNRPB. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P14678. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000125835. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR010920. LSM-related_domain. IPR001163. LSM_domain. IPR006649. LSM_domain_euk/arc. IPR017131. snRNP-assoc_SmB/SmN. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K11086. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01423. LSM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF037187. snRNP_SmB/SmN. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00651. Sm. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50182. Sm_like_riboprot. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 25817. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | RSMB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P14678 Secondary accession number(s): Q15490, Q6IB35, Q9UIS5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with