Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibrinogen beta chain

Gene

Fgb

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processAdaptive immunity, Blood coagulation, Hemostasis, Immunity, Innate immunity

Enzyme and pathway databases

ReactomeiR-RNO-114608 Platelet degranulation
R-RNO-140875 Common Pathway of Fibrin Clot Formation
R-RNO-216083 Integrin cell surface interactions
R-RNO-354192 Integrin alphaIIb beta3 signaling
R-RNO-354194 GRB2:SOS provides linkage to MAPK signaling for Integrins
R-RNO-372708 p130Cas linkage to MAPK signaling for integrins
R-RNO-5674135 MAP2K and MAPK activation

Names & Taxonomyi

Protein namesi
Recommended name:
Fibrinogen beta chain
Alternative name(s):
Liver regeneration-related protein LRRG036/LRRG043/LRRG189
Cleaved into the following 2 chains:
Gene namesi
Name:Fgb
ORF Names:Ab1-181, Ab1-216, Ac1-581
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 2

Organism-specific databases

RGDi2604 Fgb

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Add BLAST18
PeptideiPRO_000000908619 – 32Fibrinopeptide BAdd BLAST14
ChainiPRO_000000908533 – 479Fibrinogen beta chainAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi211Interchain (with alpha chain)PROSITE-ProRule annotation
Disulfide bondi215Interchain (with gamma chain)PROSITE-ProRule annotation
Disulfide bondi219 ↔ 304PROSITE-ProRule annotation
Disulfide bondi229 ↔ 258PROSITE-ProRule annotation
Glycosylationi382N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi412 ↔ 425PROSITE-ProRule annotation

Post-translational modificationi

Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei32 – 33Cleavage; by thrombin; to release fibrinopeptide BBy similarity2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiP14480

PTM databases

iPTMnetiP14480
PhosphoSitePlusiP14480

Expressioni

Gene expression databases

BgeeiENSRNOG00000007092
GenevisibleiP14480 RN

Interactioni

Subunit structurei

Heterohexamer; disulfide linked. Contains 2 sets of 3 non-identical chains (alpha, beta and gamma). The 2 heterotrimers are in head to head conformation with the N-termini in a small central domain (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiP14480, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliP14480
SMRiP14480
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini220 – 476Fibrinogen C-terminalPROSITE-ProRule annotationAdd BLAST257

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni33 – 35Beta-chain polymerization, binding distal domain of another fibrinBy similarity3

Domaini

A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.By similarity

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

GeneTreeiENSGT00760000118809
HOGENOMiHOG000059561
HOVERGENiHBG005707
InParanoidiP14480
KOiK03904
OMAiTIHNGMF
OrthoDBiEOG091G03M1
TreeFamiTF336658

Family and domain databases

CDDicd00087 FReD, 1 hit
InterProiView protein in InterPro
IPR036056 Fibrinogen-like_C
IPR002181 Fibrinogen_a/b/g_C_dom
IPR012290 Fibrinogen_a/b/g_coil_dom
IPR037580 Fibrinogen_beta
IPR020837 Fibrinogen_CS
PANTHERiPTHR19143:SF332 PTHR19143:SF332, 1 hit
PfamiView protein in Pfam
PF08702 Fib_alpha, 1 hit
PF00147 Fibrinogen_C, 1 hit
SMARTiView protein in SMART
SM00186 FBG, 1 hit
SM01212 Fib_alpha, 1 hit
SUPFAMiSSF56496 SSF56496, 1 hit
PROSITEiView protein in PROSITE
PS00514 FIBRINOGEN_C_1, 1 hit
PS51406 FIBRINOGEN_C_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P14480-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRHLWLLLLS VSLVQTQAAT TDSDKVDLSI ARGHRPVDRR KEEPPSLRPA
60 70 80 90 100
PPPISGGGYR ARPAKVDAGQ KKVERKPPDA GGCVHGDGDM GVLCPTGCEL
110 120 130 140 150
RQTLLNHERP IKNSIAELNS NINSVSETSS VTFQYLTLLK DMWKKKQAQV
160 170 180 190 200
KDNENVINEY SSILEDQKLY IDETVNDNIP LNLRVLRSIL EDLRSKIQKL
210 220 230 240 250
ESDISAQTEY CHTPCTVNCN IPVVSGKECE EIIRKGGETS EMYLIQPDTS
260 270 280 290 300
SKPYRVYCDM KTENGGWTVI QNRQDGSVDF GRKWDPYKKG FGNIATNEDT
310 320 330 340 350
KKYCGLPGEY WLGNDKISQL TRIGPTELLI EMEDWKGDKV KAHYGGFTVQ
360 370 380 390 400
TEANKYQVSV NKYKGTAGNA LMEGASQLVG ENRTMTIHNG MFFSTYDRDN
410 420 430 440 450
DGWVTTDPRK QCSKEDGGGW WYNRCHAANP NGRYYWGGLY SWDMSKHGTD
460 470
DGVVWMNWKG SWYSMRRMSM KIRPVFPQQ
Length:479
Mass (Da):54,235
Last modified:January 23, 2007 - v4
Checksum:i810698D9A65D0DE7
GO
Isoform 2 (identifier: P14480-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MRHLWLLLLSVSLVQTQAATTDSDKV → MSVPTRDTVITIHELVPNSSNSKRK
     463-479: YSMRRMSMKIRPVFPQQ → TPRQHLLLQRVPPQGSSVVMATCLHGTKCPESQLLDVHLNED

Note: No experimental confirmation available.
Show »
Length:503
Mass (Da):56,613
Checksum:i02B6A1E05E7B5C12
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28 – 30LSI → ILS AA sequence (Ref. 5) Curated3
Sequence conflicti95P → A in AAA64866 (PubMed:7841303).Curated1
Sequence conflicti126S → Y in AAA64866 (PubMed:7841303).Curated1
Sequence conflicti197I → M in AAA64866 (PubMed:7841303).Curated1
Sequence conflicti197I → M in AAA41160 (PubMed:2673932).Curated1
Sequence conflicti439L → Q in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti441S → T in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti445S → A in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti467R → K in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti475V → F in AAA41159 (PubMed:3817019).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0224921 – 26MRHLW…DSDKV → MSVPTRDTVITIHELVPNSS NSKRK in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_022493463 – 479YSMRR…VFPQQ → TPRQHLLLQRVPPQGSSVVM ATCLHGTKCPESQLLDVHLN ED in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U05675 mRNA Translation: AAA64866.1
AY321323 mRNA Translation: AAP86255.1
AY325147 mRNA Translation: AAP92548.1
AY325153 mRNA Translation: AAP92554.1
BC088102 mRNA Translation: AAH88102.1
K01336 Genomic DNA Translation: AAA98625.1
M27220 mRNA Translation: AAA41160.1
M35602 mRNA Translation: AAA41159.1
PIRiA05299
I67595
RefSeqiNP_064456.2, NM_020071.2 [P14480-1]
UniGeneiRn.11416

Genome annotation databases

EnsembliENSRNOT00000009813; ENSRNOP00000009813; ENSRNOG00000007092 [P14480-1]
ENSRNOT00000040708; ENSRNOP00000050663; ENSRNOG00000007092 [P14480-2]
GeneIDi24366
KEGGirno:24366
UCSCiRGD:2604 rat [P14480-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFIBB_RAT
AccessioniPrimary (citable) accession number: P14480
Secondary accession number(s): Q5I0P7, Q7TME5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 147 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health