Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibrinogen beta chain

Gene

Fgb

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Blood coagulation, Hemostasis, Immunity, Innate immunity

Enzyme and pathway databases

ReactomeiR-RNO-114608. Platelet degranulation.
R-RNO-140875. Common Pathway of Fibrin Clot Formation.
R-RNO-216083. Integrin cell surface interactions.
R-RNO-354192. Integrin alphaIIb beta3 signaling.
R-RNO-354194. GRB2:SOS provides linkage to MAPK signaling for Integrins.
R-RNO-372708. p130Cas linkage to MAPK signaling for integrins.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibrinogen beta chain
Alternative name(s):
Liver regeneration-related protein LRRG036/LRRG043/LRRG189
Cleaved into the following 2 chains:
Gene namesi
Name:Fgb
ORF Names:Ab1-181, Ab1-216, Ac1-581
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 2

Organism-specific databases

RGDi2604. Fgb.

Subcellular locationi

GO - Cellular componenti

  • blood microparticle Source: RGD
  • cell cortex Source: Ensembl
  • cytoplasm Source: RGD
  • external side of plasma membrane Source: Ensembl
  • extracellular exosome Source: Ensembl
  • fibrinogen complex Source: Ensembl
  • platelet alpha granule Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Add BLAST18
PeptideiPRO_000000908619 – 32Fibrinopeptide BAdd BLAST14
ChainiPRO_000000908533 – 479Fibrinogen beta chainAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi211Interchain (with alpha chain)PROSITE-ProRule annotation
Disulfide bondi215Interchain (with gamma chain)PROSITE-ProRule annotation
Disulfide bondi219 ↔ 304PROSITE-ProRule annotation
Disulfide bondi229 ↔ 258PROSITE-ProRule annotation
Glycosylationi382N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi412 ↔ 425PROSITE-ProRule annotation

Post-translational modificationi

Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei32 – 33Cleavage; by thrombin; to release fibrinopeptide BBy similarity2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiP14480.

PTM databases

iPTMnetiP14480.
PhosphoSitePlusiP14480.

Expressioni

Gene expression databases

BgeeiENSRNOG00000007092.
GenevisibleiP14480. RN.

Interactioni

Subunit structurei

Heterohexamer; disulfide linked. Contains 2 sets of 3 non-identical chains (alpha, beta and gamma). The 2 heterotrimers are in head to head conformation with the N-termini in a small central domain (By similarity).By similarity

Protein-protein interaction databases

IntActiP14480. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliP14480.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini220 – 476Fibrinogen C-terminalPROSITE-ProRule annotationAdd BLAST257

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni33 – 35Beta-chain polymerization, binding distal domain of another fibrinBy similarity3

Domaini

A long coiled coil structure formed by 3 polypeptide chains connects the central nodule to the C-terminal domains (distal nodules). The long C-terminal ends of the alpha chains fold back, contributing a fourth strand to the coiled coil structure.By similarity

Sequence similaritiesi

Contains 1 fibrinogen C-terminal domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

GeneTreeiENSGT00760000118809.
HOGENOMiHOG000059561.
HOVERGENiHBG005707.
InParanoidiP14480.
KOiK03904.
OMAiTIHNGMF.
OrthoDBiEOG091G03M1.
TreeFamiTF336658.

Family and domain databases

CDDicd00087. FReD. 1 hit.
Gene3Di3.90.215.10. 1 hit.
4.10.530.10. 1 hit.
InterProiIPR014716. Fibrinogen_a/b/g_C_1.
IPR014715. Fibrinogen_a/b/g_C_2.
IPR002181. Fibrinogen_a/b/g_C_dom.
IPR012290. Fibrinogen_a/b/g_coil_dom.
IPR020837. Fibrinogen_CS.
[Graphical view]
PfamiPF08702. Fib_alpha. 1 hit.
PF00147. Fibrinogen_C. 1 hit.
[Graphical view]
SMARTiSM00186. FBG. 1 hit.
SM01212. Fib_alpha. 1 hit.
[Graphical view]
SUPFAMiSSF56496. SSF56496. 1 hit.
PROSITEiPS00514. FIBRINOGEN_C_1. 1 hit.
PS51406. FIBRINOGEN_C_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P14480-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRHLWLLLLS VSLVQTQAAT TDSDKVDLSI ARGHRPVDRR KEEPPSLRPA
60 70 80 90 100
PPPISGGGYR ARPAKVDAGQ KKVERKPPDA GGCVHGDGDM GVLCPTGCEL
110 120 130 140 150
RQTLLNHERP IKNSIAELNS NINSVSETSS VTFQYLTLLK DMWKKKQAQV
160 170 180 190 200
KDNENVINEY SSILEDQKLY IDETVNDNIP LNLRVLRSIL EDLRSKIQKL
210 220 230 240 250
ESDISAQTEY CHTPCTVNCN IPVVSGKECE EIIRKGGETS EMYLIQPDTS
260 270 280 290 300
SKPYRVYCDM KTENGGWTVI QNRQDGSVDF GRKWDPYKKG FGNIATNEDT
310 320 330 340 350
KKYCGLPGEY WLGNDKISQL TRIGPTELLI EMEDWKGDKV KAHYGGFTVQ
360 370 380 390 400
TEANKYQVSV NKYKGTAGNA LMEGASQLVG ENRTMTIHNG MFFSTYDRDN
410 420 430 440 450
DGWVTTDPRK QCSKEDGGGW WYNRCHAANP NGRYYWGGLY SWDMSKHGTD
460 470
DGVVWMNWKG SWYSMRRMSM KIRPVFPQQ
Length:479
Mass (Da):54,235
Last modified:January 23, 2007 - v4
Checksum:i810698D9A65D0DE7
GO
Isoform 2 (identifier: P14480-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MRHLWLLLLSVSLVQTQAATTDSDKV → MSVPTRDTVITIHELVPNSSNSKRK
     463-479: YSMRRMSMKIRPVFPQQ → TPRQHLLLQRVPPQGSSVVMATCLHGTKCPESQLLDVHLNED

Note: No experimental confirmation available.
Show »
Length:503
Mass (Da):56,613
Checksum:i02B6A1E05E7B5C12
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28 – 30LSI → ILS AA sequence (Ref. 5) Curated3
Sequence conflicti95P → A in AAA64866 (PubMed:7841303).Curated1
Sequence conflicti126S → Y in AAA64866 (PubMed:7841303).Curated1
Sequence conflicti197I → M in AAA64866 (PubMed:7841303).Curated1
Sequence conflicti197I → M in AAA41160 (PubMed:2673932).Curated1
Sequence conflicti439L → Q in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti441S → T in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti445S → A in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti467R → K in AAA41159 (PubMed:3817019).Curated1
Sequence conflicti475V → F in AAA41159 (PubMed:3817019).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0224921 – 26MRHLW…DSDKV → MSVPTRDTVITIHELVPNSS NSKRK in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_022493463 – 479YSMRR…VFPQQ → TPRQHLLLQRVPPQGSSVVM ATCLHGTKCPESQLLDVHLN ED in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U05675 mRNA. Translation: AAA64866.1.
AY321323 mRNA. Translation: AAP86255.1.
AY325147 mRNA. Translation: AAP92548.1.
AY325153 mRNA. Translation: AAP92554.1.
BC088102 mRNA. Translation: AAH88102.1.
K01336 Genomic DNA. Translation: AAA98625.1.
M27220 mRNA. Translation: AAA41160.1.
M35602 mRNA. Translation: AAA41159.1.
PIRiA05299.
I67595.
RefSeqiNP_064456.2. NM_020071.2. [P14480-1]
UniGeneiRn.11416.

Genome annotation databases

EnsembliENSRNOT00000009813; ENSRNOP00000009813; ENSRNOG00000007092. [P14480-1]
ENSRNOT00000040708; ENSRNOP00000050663; ENSRNOG00000007092. [P14480-2]
GeneIDi24366.
KEGGirno:24366.
UCSCiRGD:2604. rat. [P14480-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U05675 mRNA. Translation: AAA64866.1.
AY321323 mRNA. Translation: AAP86255.1.
AY325147 mRNA. Translation: AAP92548.1.
AY325153 mRNA. Translation: AAP92554.1.
BC088102 mRNA. Translation: AAH88102.1.
K01336 Genomic DNA. Translation: AAA98625.1.
M27220 mRNA. Translation: AAA41160.1.
M35602 mRNA. Translation: AAA41159.1.
PIRiA05299.
I67595.
RefSeqiNP_064456.2. NM_020071.2. [P14480-1]
UniGeneiRn.11416.

3D structure databases

ProteinModelPortaliP14480.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP14480. 1 interactor.

PTM databases

iPTMnetiP14480.
PhosphoSitePlusiP14480.

Proteomic databases

PRIDEiP14480.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000009813; ENSRNOP00000009813; ENSRNOG00000007092. [P14480-1]
ENSRNOT00000040708; ENSRNOP00000050663; ENSRNOG00000007092. [P14480-2]
GeneIDi24366.
KEGGirno:24366.
UCSCiRGD:2604. rat. [P14480-1]

Organism-specific databases

CTDi2244.
RGDi2604. Fgb.

Phylogenomic databases

GeneTreeiENSGT00760000118809.
HOGENOMiHOG000059561.
HOVERGENiHBG005707.
InParanoidiP14480.
KOiK03904.
OMAiTIHNGMF.
OrthoDBiEOG091G03M1.
TreeFamiTF336658.

Enzyme and pathway databases

ReactomeiR-RNO-114608. Platelet degranulation.
R-RNO-140875. Common Pathway of Fibrin Clot Formation.
R-RNO-216083. Integrin cell surface interactions.
R-RNO-354192. Integrin alphaIIb beta3 signaling.
R-RNO-354194. GRB2:SOS provides linkage to MAPK signaling for Integrins.
R-RNO-372708. p130Cas linkage to MAPK signaling for integrins.

Miscellaneous databases

PROiP14480.

Gene expression databases

BgeeiENSRNOG00000007092.
GenevisibleiP14480. RN.

Family and domain databases

CDDicd00087. FReD. 1 hit.
Gene3Di3.90.215.10. 1 hit.
4.10.530.10. 1 hit.
InterProiIPR014716. Fibrinogen_a/b/g_C_1.
IPR014715. Fibrinogen_a/b/g_C_2.
IPR002181. Fibrinogen_a/b/g_C_dom.
IPR012290. Fibrinogen_a/b/g_coil_dom.
IPR020837. Fibrinogen_CS.
[Graphical view]
PfamiPF08702. Fib_alpha. 1 hit.
PF00147. Fibrinogen_C. 1 hit.
[Graphical view]
SMARTiSM00186. FBG. 1 hit.
SM01212. Fib_alpha. 1 hit.
[Graphical view]
SUPFAMiSSF56496. SSF56496. 1 hit.
PROSITEiPS00514. FIBRINOGEN_C_1. 1 hit.
PS51406. FIBRINOGEN_C_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFIBB_RAT
AccessioniPrimary (citable) accession number: P14480
Secondary accession number(s): Q5I0P7, Q7TME5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 1, 1990
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 138 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.